Sentencedict.com
 Directly to word page Vague search(google)
Home > Transition in a sentence

Transition in a sentence

  up(11)  down(5)
Sentence count:198+11Posted:2016-07-16Updated:2020-07-24
Synonym: changeconversiontransfertransformationSimilar words: transittransactiontranslationtransformationtransportationtransientpositiontransmissionMeaning: [træn'sɪʃn ,-z-]  n. 1. the act of passing from one state or place to the next 2. an event that results in a transformation 3. a change from one place or state or subject or stage to another 4. a musical passage moving from one key to another 5. a passage that connects a topic to one that follows. v. 1. cause to convert or undergo a transition 2. make or undergo a transition (from one state or system to another). 
Random good picture Not show
91 Punctuation marks are classified as separate syntactic categories and grammars and transition matrices based around this assumption.
92 But the analogies which are used to justify the transition are dubious at best.
93 Most languages, when arrayed in order, offer a rhythmic transition series or sensory structure.
94 However, they require the cuts to be made to high standards of accuracy so that the transition is made smoothly.
95 As a way to ease that transition, the Department of Defense has agreed to allow it to become a redevelopment area.
96 The glass transition Glass, familiar for centuries, is a solid material showing no crystalline structure.
97 This could represent a humid climate during the glacial-interglacial transition between stages 8 and 7 of the marine 18 O record.
98 Cypress has no plans to develop future Sparc products but it will continue to handle distribution during the transition.
99 There is no sharp distinction between the later stages of transition and the earlier ones of turbulent motion.
100 Later, people spend hours reconstructing that brutal transition from the nowhere to the everywhere,(www.Sentencedict.com) when nature can destroy you.
101 The alliance was created to help the transition from a defense-dominated economy to more diverse industries.
102 It seems to have been a religion that was in transition, which may explain some startling contradictions or apparent contradictions.
103 A full appreciation of intentions in moral judgments begins to develop around the transition from concrete to formal operations.
104 The lessons learnt should be of great value to the analysis of other countries in the process of transition.
105 Adolfo Suarez supervised Spain's transition to democracy in the 1970s.
106 The government was to be responsible for executing decisions of the conference during a transition to multiparty democracy.
107 These authors identify two conflicting influences on total labor requirements that arise during this transition.
108 Braun even passed that test[sentencedict.com], although the transition was so abrupt that he left some of us leaning the wrong way.
109 But Golding said she would work with Huntington Beach officials to ease his transition.
110 This meeting was to air grievances and ease our transition into the future.
111 Through figurative abstracted works on paper, Tempe artist Ron Bimrose taps into light themes like transition, fate and personal choice.
112 Officials from one country told Ellena that its citizens had enough stress coping with high unemployment and other transition ills.
113 It may be desirable to spend what could otherwise be dole money on temporarily subsidizing lame ducks to ease the transition.
114 It was Schindler who stepped in at that moment to ease the transition to the right.
115 The transition will demonstrate to individuals the importance and value of periodic re-direction in their lives.
116 Under the terms of the agreement a state of transition was established prior to the creation of the third republic within 18 months.
117 For their part, opposition leaders demanded that Mr Fujimori step down immediately in favour of a transition government.
118 Before considering the possible applications of the dynamical transition paradigm, it is necessary to clearly delineate this restricted domain of application.
119 Then again, the transition to digital television could take much longer than expected.
120 Second, Labour under Mr Kinnock is belatedly making the transition to continental-style social democracy.
More similar words: transittransactiontranslationtransformationtransportationtransientpositiontransmissionoppositioncompositionacquisitiontraditiontraditionaltraditionallysensitivetransformtransfertransmitsensitivitytransporttranslatemansionexpansionactive transportsituationeditionadditionconditionmunitionscoalition
Total 198, 30 Per page  4/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words