Sentencedict.com
 Directly to word page Vague search(google)
Home > Asthma in a sentence

Asthma in a sentence

  up(1)  down(4)
Sentence count:235+8Posted:2017-03-04Updated:2020-07-24
Synonym: asthma attackbronchial asthmaSimilar words: as thoughfreshmanbrahmanaplaster castrhythmalgorithmbiorhythmarithmeticMeaning: ['æsmə]  n. respiratory disorder characterized by wheezing; usually of allergic origin. 
Random good picture Not show
91. Each practitioner was invited to record details of all patients who presented with an asthma attack during a predetermined three month period.
92. The deaths linked to Zyban include heart attacks, suicides, brain disorders and asthma attacks.
93. The condition of the 60 year-old actress, who is believed to have suffered a severe asthma attack, worsened since yesterday.
94. This indicates an annual mortality from asthma of just over 1/100000.
95. It can aggravate asthma and bronchitis and cause coughing, choking and impaired lung function, particularly in people who exercise.
96. There are a number of medications available to treat asthma attacks and to prevent attacks in the first place.
97. In a large sample of adolescents low birth weight was associated with increased prevalence of asthma.
98. But they did not know beforehand that one of the children they were about to take suffered from asthma.
99. Still, the smell of smoke inevitably triggers an asthma attack.
100. Initiatives to improve understanding of the burden of ill health due to asthma would be welcome.
101. The ensuing symptoms are often difficult to distinguish from those of an acute attack of asthma.
102. One of my students suddenly had an attack of asthma and I didn't know what to do.
103. Maberly and I reported results in inpatients with asthma and are doing an outpatient double blind randomised trial of neutralisation.
104. People lived a long time with fluid ... asthma ... emphysema ... years.
105. She's coped with asthma and she's sure her children could.
106. Other evidence suggests it can be fatal to people with certain medical conditions, such as asthma.
107. Immunology recommends allergy shots as an effective way to control moderate to severe asthma.
108. We were later told about Piggy's asthma which stopped him from doing many physical things like swimming and running.
109. In real life she'd been a poor shepherdess who lived in a dungeon and had asthma.
110. This survey aimed to provide some baseline information regarding their current procedures for ensuring quality of care in general practice asthma clinics.
111. The 380 members of the General Practitioners in Asthma Group were invited to participate in the audit. Sentencedict.com
112. They're living proof that asthma can be passed from generation to generation.
113. Only 1 of 6 observed episodes of asthma was believed by the clinical investigators to be related to therapy.
114. The study offers hope to allergy and asthma sufferers, Bloom said.
115. There is one ailment where learning to relax is of special importance, and that is asthma.
116. Seizures occasionally occur in patients taking theophylline for control of bronchial asthma.
117. ET-1 mRNA and mature peptide have been localised to the pulmonary epithelium of healthy subjects and those with asthma.
118. But her son's children, although they might carry the gene, won't get asthma.
119. One child in ten is affected and, in 1990, there were 98 deaths among five-to-24-year-old asthma sufferers.
120. The seventh son of a seventh son has traditionally been able to heal conditions such as eczema and asthma.
More similar words: as thoughfreshmanbrahmanaplaster castrhythmalgorithmbiorhythmarithmeticless thanaestheticprostheticanestheticaestheticsno less thanstone's throwkinestheticaestheticallypass throughacross the boardhope against hopeas topasteastfasthastevastwastecastmastlast
Total 235, 30 Per page  4/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words