Sentencedict.com
 Directly to word page Vague search(google)
Home > Fasting in a sentence

Fasting in a sentence

  up(3)  down(3)
Sentence count:126Posted:2017-03-04Updated:2020-07-24
Similar words: boastingeverlastingfastidiousfascinatingstingyprocrastinatetestingpostingMeaning: [fæst /fɑːst]  n. abstaining from food. 
Random good picture Not show
61 Second, fasting blood glucose tests and an EKG should be done regularly.
62 We know that prayer acquires power if it is joined with fasting and almsgiving.
63 "There are seven or eight Muslim kids at my school that are fasting, " said Romaze Akram, 15, who lives in Newburgh but goes to the Signature School in Evansville.
64 Defraud ye not one the other, except it be with consent for a time, that ye may give yourselves to fasting and prayer; and come together again, that Satan tempt you not for your incontinency .
65 Conclusion Mental nursing care before fasting hemospasia could obviously decrease the occurrence of hemospasia induced responses.
66 In 1135 they became part of the Cistercian order of monks, whose rules required regular fasting, long periods of silence and strict religious observances .
67 A person has impaired fasting glucose (IFG) when fasting plasma glucose is 100 to 125 mg/dL.
68 Objective: to study the acid level and fasting glucose and II diabetes.
69 Then, with vigour and vitality love tragicomedy staged. And family quarrels, fasting, to do almost all try again.
70 The boy lay on his bed, pale and thin from fasting.
71 And in every province, whithersoever the king's commandment and his decree came, there was great mourning among the Jews, and fasting, and weeping,(http://sentencedict.com/fasting.html) and wailing; and many lay in sackcloth and ashes.
72 So I turned to the Lord God and pleaded with him in prayer and petition, in fasting, and in sackcloth and ashes.
73 But Gandhi's great grandson, Tushar Gandhi, says there are crucial differences in the way the two leaders have used fasting as an instrument of protest.
74 This pre-Easter period was also a time of fasting for all Christians in the Roman church.
75 Cellulase activities of digestive tract chyme were increased significantly by exogenous enzyme, but also reduced significantly by fasting.
76 The fasting blood of ulnar vein and cerebrospinal fluid were collected in 30 first episode paranoid schizophrenics and 20 patients of cerebral trauma without psychotic disease(as the control group).
77 Migrating Myoelectric Complex (MMC) were obtained from silver bipolar electrodes implanted in duodenum and jejunum of fasting rats respectively.
78 "This is one of the greatest aspects of the fasting month in this country, " said Hajji Ramadan Mukhtar , who took his place beside others on the table.
79 Method Fasting blood sugar levels of fulminating hepatitis patients were retrospectively analyzed.
80 Jainism is unique in allowing the very spiritually advanced to hasten their own death by certain practices (principally fasting) and under specified circumstances.
81 My knees give way from fasting; my body is and gaunt.
82 Fasting certainly bring benefits to physical well - being, but for believers, it is, in the first place, a "therapy" to heal all that prevents them from conformity to the will of God.
83 When I wept in my soul with fasting, It became my reproach.
84 Conclusions: Although fasting hypoglycemia is characteristic of patients with insulinoma, postprandial symptoms have been reported with increasing, albeit low frequency.
85 In addition, monophosphate - activated protein kinase ( AMPK ) levels were high during fasting and low during HF diet.
86 By contrast, subjects in the nonalcoholic - beer group experienced no real change in fasting plasma glucose.
87 Carnival is an annual celebration before Lent, a 40-day period of fasting that precedes Easter. The dates of Carnival vary each year depending on the date of Ash Wednesday, the first day of Lent.
88 Metho-ds The levels of plasma IGF-1, serum insulin and fasting blood-glucose in 21 patients with MND were determined with radioimmunoassay (RIA), and set up the control group.
89 We measured activin A, inhibin B and FST levels in serum samples collected every 15min for 24hr on the third day of study A and the third fasting day of study B, using commercially-available ELISAs.
90 Half the year was devoted to Lenten fasting prescribed by religion, and even marriage was discouraged.
More similar words: boastingeverlastingfastidiousfascinatingstingyprocrastinatetestingpostingexistingprocrastinationexhaustingstinginessdevastatingdistinguishinterestingstimulatingdistinguishedundistinguishedfastfastensteadfastbreakfasthard and faststintswastikamastiffpastimedrasticplasticchastise
Total 126, 30 Per page  3/5  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words