Sentencedict.com
 Directly to word page Vague search(google)
Home > Comprise in a sentence

Comprise in a sentence

  up(8)  down(12)
Sentence count:155+1Posted:2016-07-21Updated:2020-07-24
Synonym: consist ofcontainincludeinvolveSimilar words: compromiseenterpriseariseprisonercomprehensivecomprehensiongive rise tocomprehensibleMeaning: [kəm'praɪz]  v. 1. be composed of 2. include or contain; have as a component 3. form or compose. 
Random good picture Not show
(121) Cost is the efficiency of resource allocation in essence, according to the author's opinion, the foundational elements of cost comprise the utility of resource and the factor of time.
(122) As Figure 1 illustrates, the classes that comprise the TCS prototype are bundled into four packages: the transaction package, the service package, the utility package, and the exception package.
(123) The optical system of the device comprises a lens, a reflecting lens, a projection screen, etc. Other parts of the device comprise image films with various hair style modes.
(124) Sea vegetables rich in vitamins and minerals should also comprise a small portion of a macrobiotic diet.
(125) Exciting magnetism, multi-band, band-pass amplifier, phase-sensitive detector, the part of integral and feedback and compensation of temperature and so on comprise the design of circuit.
(126) Results GL-PPT2, GL-PPT3, and GL-PPT4 comprise the nine monosaccharides of mannose, ribose, rhamnose, glucose, galactose, arabinose, xylose, galactose, and glucuronic acid.
(127) Accounting statements shall at least comprise a balance sheet, an income statement a cash flow statement.
(128) According to research firm IDC, tablets comprise about 1 % the global portable PC market.
(129) A tuner, a detector, and an AF amplifier comprise the radio.
(130) Long - term assets comprise long - term investments, fixed assets, intangible assets, deferred assets and other long - term assets.
(131) The product-oriented application silos that comprise most core banking solutions lead to data redundancy for core bank data domains, such as customer and product data.
(132) What kinds of equipment does an on-load tap changer comprise?
(133) The works mainly comprise the body cells, cell fusion, nuclear transplantation, cell uptake and the reorganization of chromosome segment.
(134) It maintain the security database which list all the valid user, group, and organization that comprise the secure domain.
(135) The findings on the chest film comprise volume loss and fibrotic changes in the basal lung area.
(136) Because keepalive message exchanges often comprise the vast majority of activity for devices that are frequently idle, this technique extends their battery life significantly.
(137) A single motor neuron may innervate more than one fiber. A motor neuron plus all of the muscle fibers that it innervates comprise a motor unit.
(138) Article 12 An arbitration commission shall comprise a chairman, two to four vice-chairmen and seven to eleven members.
(139) The contingent would comprise 156 personnel below officer rank and 91 officers (inclusive of 10 members of 'Garud' IAF Special Force team).
(140) Four species, White Spruce (Picea glauca), Engelmann Spruce (Piceaengelmanni), Lodgepole Pine (Pinus contorta), and Alpine Fir (Abieslaciocarpa) comprise the spruce-pine-fir species group.
(140) Sentencedict.com is a sentence dictionary, on which you can find excellent sentences for a large number of words.
(141) The device and the base station comprise a scan code acquisition module, a transmitting module and a receiving module.
(142) The rotor structure of claim 1, wherein said tension bar means comprise openings, said blade angle bearing means being located in said openings thus forming inner bearing means.
(143) A foreign arbitration commission shall comprise one chairman, several vice-chairmen and several committee members.
(144) In Listing 2, a few countries are detected through a simple list of names that comprise the regular expression.
(145) Conceptual Modeling Engineering ( CME ) is comprise of targets processes methods and tools of conceptual modeling.
(146) Dementing illnesses comprise Alzheimer's disease(AD), Pick's disease, Multi infarct dementia(MID) and other neurological disorders. These diseases have different clinical characters respectively.
(147) Catalysts for converting polyalkylaromatics to monoalkylaromatics, particularly cumene and ethyl benzene are disclosed which comprise aY-85 or a modified LZ-210 zeolite.
(148) Class diagrams model the static structure of a system: the objects that comprise the system, as well as the relationships among the objects within the system.
(149) Raw materials of the fertilizer at least comprise sea tangle and seaweed.
(150) The Great Smoky Mountains, created in 1934 in parts of North Carolina and Tennessee, comprise one of the largest protected land areas in the eastern United States.
More similar words: compromiseenterpriseariseprisonercomprehensivecomprehensiongive rise tocomprehensiblesurprisingcomparisonsurprisinglyby comparisonin comparison withimpressimprovedimpressiveimpressionraiseadvisecruiseadviserpremiseprecisefranchiselikewiseexpertiseprimepriceprizeprint
Total 155, 30 Per page  5/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words