Sentencedict.com
 Directly to word page Vague search(google)
Home > Comprise in a sentence

Comprise in a sentence

  up(8)  down(12)
Sentence count:155+1Posted:2016-07-21Updated:2020-07-24
Synonym: consist ofcontainincludeinvolveSimilar words: compromiseenterpriseariseprisonercomprehensivecomprehensiongive rise tocomprehensibleMeaning: [kəm'praɪz]  v. 1. be composed of 2. include or contain; have as a component 3. form or compose. 
Random good picture Not show
(91) Lycopodium and related genera comprise the common clubmosses or (North America) ground pines.
(92) The innovational steps comprise raveling out the flood peak of letters and calls, constituting the law of letters and calls, establishing the Ombudsman of letters and calls.
(93) Two movable towers and movable partition walls comprise the parterre and define the stage opening.
(94) Motor units comprise a motoneuron and the muscle fibers it innervates.
(95) The High Court shall comprise the Court of Appeal and the Court of First Instance.
(96) Simulant system for training comprise of the transit instrument which has been provided by optical measure equipment without any change and the newly developed simulant sub-system for training.
(97) The catalysts comprise a vinylpyridine polymer and a titanium zeolite.
(98) The papers that comprise this special issue are then introduced and manuscript reviewers are acknowledged.
(99) The front end circuits comprise a plurality of programmable channel circuits for converting received digital signals into selected one of a plurality of analog network.
(100) The tepee-like tents and crude hide huts that comprise tauren towns stand in stark contrast to the turning windmills and pulley structures that keep the tauren grainmills operating.
(101) There are already existing continuous glucose monitors, but these tend to be devices which comprise of a needle-like sensor and an external unit which protrudes in an unsightly way from the skin.
(102) They comprise two-thirds of the bank holding company assets in the United States, the Fed said in a fact sheet.
(103) Each supporting units is a sealed columnar structure which is manufactured by adopting the alloy wires, and comprise a plurality of wave shape units.
(104) The source region and the drain region comprise a semiconductor junction mixedly formed by a Schottky junction and a P-N junction.
(105) Fusion proteins that comprise at least one subunit of glutelin and a desired protein permit enhanced production of the desired protein in a useable form in plants.
(106) Botnets generally comprise thousands of malware-infected zombie computers that are controlled remotely by a host to carry out a wide array of seemingly untraceable attacks.
(107) If the chief justice is part of the majority(sentencedict.com), he will assign the drafting of the legal opinion to himself or to one of the other justices who comprise the majority in a given case.
(108) Create a large image made up of smaller tiles that comprise a subject related to the pie slice.
(109) This tissue plays a minor role in erections, since a hard-on is due mostly to the two sandwiched strips of corpora cavernosa, which comprise the bulk of the shaft.
(110) In addition, the ideal wage makeup should comprise the base pay, post pay, longevity pay and bonus, and each part accounted for 21.0%, 47.3%,[www.Sentencedict.com] 6.5% and 25.2% respectively.
(111) These waterborne and other environmentally - friendly technologies comprise acrylics, urethanes, urethane - acrylics , vinyl acrylics and other copolymers.
(112) The volcanic successions comprise thick piles of basaltic lavas and subordinate intermediate and silicic lavas and pyroclastics.
(113) The water-soluble macromolecule (B) can also comprise polyoxyalkylene polymer (B2).
(114) Such quantum processors further comprise a set of readout devices each configured to measure the information from a corresponding quantum device in the plurality of quantum devices.
(115) The ratio of long-term funds with a fixed interest charge, such as debentures , that comprise a company's capital to its ordinary share capital.
(116) The feedback joint detection algorithms mainly comprise zero forcing block decision feedback equalizer (ZF-BDFE) and minimum mean-square-error block decision feedback equalizer (MMSE-BDFE).
(117) Water laws of California, USA as a mixed system comprise of riparian right, priority appropriation right and other kinds of water rights.
(118) Second, the lords spiritual comprise 26 out of 738 lords in the House of Lords, so their influence is negligible.
(119) First of all, raw materials manufactured components comprise the initial input in the entire manufacturing process.
(120) Choose two fields from the database table that comprise the primary key.
More similar words: compromiseenterpriseariseprisonercomprehensivecomprehensiongive rise tocomprehensiblesurprisingcomparisonsurprisinglyby comparisonin comparison withimpressimprovedimpressiveimpressionraiseadvisecruiseadviserpremiseprecisefranchiselikewiseexpertiseprimepriceprizeprint
Total 155, 30 Per page  4/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words