Sentencedict.com
 Directly to word page Vague search(google)
Home > Comprise in a sentence

Comprise in a sentence

  up(8)  down(13)
Sentence count:155+1Posted:2016-07-21Updated:2020-07-24
Synonym: consist ofcontainincludeinvolveSimilar words: compromiseenterpriseariseprisonercomprehensivecomprehensiongive rise tocomprehensibleMeaning: [kəm'praɪz]  v. 1. be composed of 2. include or contain; have as a component 3. form or compose. 
Random good picture Not show
(61) Comparisons to other technologies, such as statistical methods and expert systems, comprise the bulk of chapter 6.
(62) Reconstruction procedures comprise composition, corporate reorganization and corporate reconstruction.
(63) Tibetan tribal laws comprise "identity inheritance" and "property inheritance.
(64) The foreign-born now comprise 12 percent of Americans.
(65) Random noises have uniform rules and they comprise of circumstance noise, measurement error and ground microseism.
(66) The Library will be located in the former Courthouse and the headquarters of the Judiciary Police on Avenida da Praia Grande and Rua Central which comprise a total floor space of 22,000 sq meters.
(67) A device in which the code implementing the described embodiments of operations is encoded may comprise a computer readable medium or hardware logic.
(68) The genome projects comprise the structural genomics focusing on determining the complete sequences of the genome and the functional genomics focusing on elucidating the biological function of genes.
(69) Main products of Lionpower comprise: Pan Feeding System, Nipple Drinking System, Cooling pads and Fan ventilation system, Environment Control System, High Pressure Spray System.
(70) Each sub-group will comprise both secondary and primary school principals as well as academics.
(71) Again, we can apply this thinking to a development environment -- i.e., we must define the various aspects of each of the elements that comprise it.
(72) The utility model discloses a pair of pet short pants which comprise a pants body and a cloth bag connected with the pants body via a first connecting piece.
(73) One or more of the hollow wheel gear, two or more planet gears, and sun gear comprise a plurality of teeth 4 that have been superfinished to a final surface roughness of 0.25 micron or less.
(74) Five states were to comprise the Federation of Malaysia. Four of them were Malaya , Brunei, Sarawak and Singapore. Which was the fifth?
(75) Women still comprise the majority of the world's poor, unfed, and unschooled.
(76) This paper expounds that the price factors of mineral resources comprise three parts, which include differential rent, absolute rent and the cost of exploration.
(77) On the cylindrical face, a number of grinding or polishing modules (17, 18) are provided that comprise hold-back means, preferably in the shape of brushes (13).
(78) Therein, crimping head components comprise crimping box, crimping rollers and crimping block.
(79) Hand forging tools comprise variously shaped hammers. The base on which the work is supported during forging is the anvil.
(80) Known strand guiding devices comprise a segment frame and at least one pair of opposing guiding rollers, between which the metal strip is guided.
(80) Sentencedict.com is a online sentence dictionary, on which you can find good sentences for a large number of words.
(81) The Kunlun Mountains comprise the East, Middle and West Kunlun Mountains.
(82) Terminals will comprise a mix of self-service automation including not only full scan, weigh and bag units but also self-pay terminals and mobile self-scanning systems.
(83) The Turkish Straits connect the Black and Aegean Seas and comprise the Bosphorus, the Sea of Marmara and the Dardanelles.
(84) The electron collector may comprise first and second ends, wherein the first end is attached to the image forming substrate and the second end faces the electron emission substrate.
(85) Subaerial volcanic rocks mainly comprise lavas, clastic lava, pyroclastic rocks and sedimentary pyroclastic rocks.
(86) A silicon nitride film may comprise an initiation layer formed in the absence of a hydrogen gas flow, underlying a high stress nitride layer formed in the presence of a hydrogen gas flow.
(87) Electrical elements used in the invention only comprise an electromagnetic relay and a single-pole double-throw switch and can bear severer external environment.
(88) Low specific speed centrifugal pump comprise a large proportion of fluid machinery, and have more and more application in varied fields.
(89) Paramyxovirus structural proteins within a virus-like particle (VLP) comprise one example of such a vaccine.
(90) IIIRM comprise conceptual structure of integrated information architecture and coherent description of all its layers and key components.
More similar words: compromiseenterpriseariseprisonercomprehensivecomprehensiongive rise tocomprehensiblesurprisingcomparisonsurprisinglyby comparisonin comparison withimpressimprovedimpressiveimpressionraiseadvisecruiseadviserpremiseprecisefranchiselikewiseexpertiseprimepriceprizeprint
Total 155, 30 Per page  3/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
  • me 2023-08-06 08:13:48
    .
  • Grace 2023-02-28 14:33:10
    ∞                                                                                                                            ∞                                                                                                                            . ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                         
  • Angelita 2023-02-24 13:07:12
    .                                                                                                                            .                                                                                                                            I like spicy meatballs                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                   
  • Leo 2023-02-24 00:52:56
    .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                        
  • Grace 2023-02-23 18:54:21
    .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                        
  • Willie 2023-02-23 14:01:41
    .                                                                                                                            .                                                                                                                            Good morning                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                             
  • Marcos 2023-02-23 13:58:38
    .                                                                                                                            .                                                                                                                            Good morning                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                             
  • Marcos 2023-02-22 14:03:44
    .                                                                                                                            .                                                                                                                            Good morning                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                             
  • Gandolf 2023-02-21 22:48:05
    .                                                                                                                            .                                                                                                                            ******\ Why are people using this? PonyExpress is 10X better! /************                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                              
  • ☑☑☑Approved User☑☑☑ 2023-02-15 18:42:41
    .                                                                                                                            .                                                                                                                            .                                                                                                                            I think lengusa.com is MUCH better than this site. Google lengusa and search the same keyword...                                                                                                                           .                                                                                                                            .                                                                                                                            .                                                                                                                            .                              
More words