Sentencedict.com
 Directly to word page Vague search(google)
Home > Ceiling in a sentence

Ceiling in a sentence

  up(4)  down(5)
Sentence count:285+20Posted:2016-07-16Updated:2026-04-17
Antonym: floorSimilar words: boiling waterclingrulingrollingsiblingcompellingcounselingfulfillingMeaning: ['siːlɪŋ]  n. 1. the overhead upper surface of a room 2. (meteorology) altitude of the lowest layer of clouds 3. an upper limit on what is allowed 4. maximum altitude at which a plane can fly (under specified conditions). 
Random good picture Not show
121, On the walls I applied the same technique as I had used for the ceiling.
122, Karen lay on her back, staring up at the ceiling.
123, There was no air conditioning, just a ceiling fan turning slowly.
124, The study was lined from floor to ceiling on every wall with bookcases.
125, The agreement sets the ceiling of twenty-two-point-five million barrels a day on OPEC production.
126, One would need a long reach to be able to touch the ceiling.
127, I'm going to paint the walls white and the ceiling pink.
128, The ceiling was richly gilt and picked out in violet.
129, Once the walls of the room are up, let in the ceiling.
130, On the bathroom ceiling, some pieces of plaster had fallen away.
131, Goodhue shattered the glass ceiling as the first female publisher at Time Inc.
132, Restoration work on the Sistine Chapel ceiling is now complete.
133, If the TV was built into the ceiling,(http://sentencedict.com/ceiling.html) you could lie there while watching your favourite programme.
134, The advisory committee did not apply for a general increase in the ceiling.
135, He then stencilled the ceiling with a moon and stars motif.
136, The ceiling came down.
137, We asked our builder to estimate for the repair of the ceiling.
138, The government imposed a ceiling on imports of foreign cars.
139, Forby lay awake but staring blankly at the ceiling.
140, A lone naked bulb dangled from the ceiling.
141, At that point there is a ceiling on contributions.
142, Fragments of dried earth fell from the ceiling.
143, Angels and biblical scenes covered the ceiling.
144, The Chancellor has set a ceiling of £250,000.
145, Genius is Michelangelo at work on the Sistine ceiling.
146, Can I scuttle across the ceiling?
147, A single electric bulb dangled from the ceiling.
148, Lights from the traffic fled across the ceiling.
149, Top floor rooms may have a sloping ceiling.
150, First, there was the Gorilla, flying through the air on a rope suspended from the ceiling before the game started.
More similar words: boiling waterclingrulingrollingsiblingcompellingcounselingfulfillingunsettlingwillingnesssurveillancereceiveperceiveconceivereceiverperceivedonce in a whileutilityabilityutilizefamiliarcivilianfacilitymilitarylinklinestabilityliabilitycall inblink
Total 285, 30 Per page  5/10  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words