Sentencedict.com
 Directly to word page Vague search(google)
Home > Sweet in a sentence

Sweet in a sentence

  up(10)  down(3)
Sentence count:150+42Posted:2017-02-13Updated:2020-07-24
Synonym: adorableagreeablecharminglovelypleasantsaccharinesugaryAntonym: sourSimilar words: sweetensweetenersemisweetbittersweetsweepsweep upweeweekMeaning: [swɪːt]  n. 1. English phonetician; one of the founders of modern phonetics (1845-1912) 2. a dish served as the last course of a meal 3. a food rich in sugar 4. the taste experience when sugar dissolves in the mouth 5. the property of tasting as if it contains sugar. adj. 1. having or denoting the characteristic taste of sugar 2. having a sweet nature befitting an angel or cherub 3. pleasing to the ear 4. pleasing to the senses 5. pleasing to the mind or feeling 6. having a natural fragrance 7. (used of wines) having a high residual sugar content 8. not containing or composed of salt water 9. not soured or preserved 10. with sweetening added. adv. in an affectionate or loving manner (`sweet' is sometimes a poetic or informal variant of `sweetly'). 
Random good picture Not show
121. They wrote in the old days that it is sweet and fitting to die for one's country. But in modern war, there is nothing sweet nor fitting in your dying. You will die like a dog for no good reason. Ernest Hemingway 
122. Sweet is the voice of a sister in the season of sorrow. Benjamin Disraeli 
123. Flowers are like the sweet babies of the nature; they make us to smile. Mehmet Murat ildan 
124. Sweet spring, full of sweet days and roses, a box where sweets compacted lie. George Herbert 
125. The holy passion of friendship is so sweet and steady and loyal and enduring in nature that it will last through a whole lifetime, if not asked to lend money. Mark Twain 
126. Glycerin is a thick sweet colorless liquid.
127. Properties: Yellow granule, sweet. The water solution is suspension.
128. His glib talk sound as sweet as a song!
129. The peasants'revolt disturbed the gentry's sweet dreams.
130. His glib talk sounds as sweet as a song.
131. Sweet Xie Ju, composite herb, produce Guyana formerly.
132. PETRUCHIO. Tell me , sweet Kate, and tell me truly too, Hast thou beheld a fresher gentlewoman?
133. I also like Gold Dust, but I don't think it's as good as Sweet Girl.
134. Instead, I heard only the sweet, soft gurgle of baby laughter.
135. Not that it isn't a very sweet frock, darling, but -- well,(sentencedict.com) it does look a bit worn.
136. The product , glutinous, taste sweet and has thin peel, but without residue.
137. The Zhangqiu green onion has high, long, crisp, the sweet prominent characteristic.
138. For fruit juice , I prefer either guava or grapefruit because they are not too sweet.
139. Frankincense is a type of sweet - smelling gum from a tree.
140. Please listen to the depths of the season, a sweet - bi voiceless, to gurgle out.
141. He'll get around to it in the sweet by - and - by.
142. Frankincense, Carrot Seed, Rose, Sweet Almond, Jojoba and so on.
143. Aroma: Full rich red fruit aromas of jam , peppery and spicy with sweet green pepper notes.
144. When these flowers frill bloom they send forth a fragrance at once delicate and sweet.
144. Sentencedict.com is a online sentence dictionary, on which you can find excellent sentences for a large number of words.
145. Maggie : It's sweet dumplings made of glutinous rice flour.
146. Its fruitage is succulency and sweet , and it owns abundant nutrition.
147. Miraculin is an alkaline glycol - protein which can transform sour to sweet taste.
148. Butterfly: so how to turn that tree from a poisonous tree to a sweet fruit tree?
149. The homemade fois gras ( goose liver on toast ) with sweet jam a popularity among regular patrons.
150. Pitching cake with each other at birthday party is the most common scene — sweet, frolic, hurt, happiness or endurance?
More similar words: sweetensweetenersemisweetbittersweetsweepsweep upweeweekweepweedsweatswellswearweeklyweed outas wellanswerswerveseethesee tofeetsheetmeetweepingweekdayweekendbetweensweatergreetfleet
Total 150, 30 Per page  5/5  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words