Sentencedict.com
 Directly to word page Vague search(google)
Home > Penicillin in a sentence

Penicillin in a sentence

  up(2)  down(0)
Sentence count:217+7Posted:2017-03-19Updated:2020-07-24
Similar words: illicitfill inillicitlywillingmillingspillingwillinglythrillingMeaning: [‚penɪ'sɪlɪn]  n. any of various antibiotics obtained from Penicillium molds (or produced synthetically) and used in the treatment of various infections and diseases. 
Random good picture Not show
61. Penicillin G Sodium for Inj.
62. For such patients, benzathine penicillin by injection monthly is recommended.
63. It'should not be combined with acidic medicine , e . g . vitamin C, calcium chloride , penicillin, etc.
64. The warnings is specified in this paper about the Penicillin intracutaneous hypersensitive test .
65. Results the Penicillin G Benzathine injection had mild allergy effect and no muscle stimulation.
66. The lactating and creep rations can be medicated with 200 - 300 g of phenoxymethyl penicillin.
67. The clinical efficacies of 133 cases of gonorrhea treated with ofloxacin, ciprofloxacin, spectinomycin and penicillin G were reported.
68. Sir Alexander Fleming alighted on the antibiotic properties of penicillin while he was engaged on research of a quite different nature.
69. The wistar rat epilepsy model was reproduced by injecting penicillin, pentylenetrazol and bemegride intraperitoneally.
70. Major applicate as analgesics, emulsifier and dispersant in fat emulsion agent, anti-tumor agent, penicillin additive, the natural activity componentphospholipid complex and artificial blood etc.
71. The frequency of cefoperazone was maximum in the first-select anti-infectious, next were levofloxacin, amikacin,(www.Sentencedict.com) and penicillin.
72. Minimum inhibitory concentrations (MICs) of penicillin, ceftriaxone, tetracycline, ciprofloxacin and spectinomycin were determined by an agar plate dilution method.
73. Conclusion The different dose of OMT and SOP can produce different influences on the epileptiform activity induced by penicillin.
74. A brief statement was made on the antigenic determinant in Penicillin, mechanism of Penicillin Hypersensitive reaction and also the reaction type.
75. Objective:Improving the earning ratio on sodium salt azeotropism crystallization in the process of refining Penicillin is vital important to the total rates of return in producing Penicillin.
76. I'll give you a shot of penicillin to bring down the fever.
77. Conclusions The usage of the new immobilized penicillin acylase reactor in the 6-APA production will result in a higher yield of 6-APA and lower loss of immobilized penicillin acylase.
78. Among the Bacteria susceptible to penicillin are those causing strep throat, spinal meningitis, gas gangrene, and syphilis.
79. E. coli cells having high penicillin acylase activity were entrapped in gelatin gel and crosslinked with glutaraldehyde.
80. The modified penicillin acylase was mainly present in the PEG phase in a PEG-dextran aqueous two-phase system, and the partition coefficient was 25.
81. The penicillin sensitivity test and L phase test for the Pseudomonas pseudomallei were conducted to clarify the role of serum antibody and complements in bacteriocidal action.
82. Occupational dermatoses in the processing of penicillin at a pharmaceutical factory in Shanghai were reported.
83. Objective To establish a kind of method for using high-performace liquid chromatography to measure macromolecules foreign substance in dispersible tablets of Penicillin V Potassium.
84. Penicillin, for instance, prevents the final cross - linking step, or transpeptidation, in the macromolecule's assembly.
85. Also in the choroid plexus, organic acids ( eg, penicillin ) are actively transported from CSF to blood.
86. Result: 20 cases of anaphylactic shock were attributed to oral penicillins agents, of which, 8 cases were caused by penicillin V potassium tablet, 8 cases by amoxicillin, 4 cases by ampicillin.
87. It is indicated for cellulitis, septicemia, pyemia, pyoderma, etc. , caused by strains which is resistant to penicillin, ampicillin, erythromycin, and these infections can be controlled rapidly by it.
88. Hydroxyl magnetic microspheres were prepared with suspension polymerization and then activated withepichlorohydrin for immobilization of penicillin G acylase.
89. We detected penicillin ( BPO , 6 - APA , BPE ) specific IgE by ELISA with mono - clonal antibodies ( McAb ) and biotin - avidin system ( BAS ), and discussed its clinical signifi - cance.
90. Comparing to sodium penicillin, sanguinarine marked inhibitory effect, toward staphylococcus aureus bacteria and e. coli in the antimicrobial effect were higher than penicillin sodium.
More similar words: illicitfill inillicitlywillingmillingspillingwillinglythrillingfulfillingwillingnessunwillingnesspencildomicilepencil boxpencil casepenisvacillateoscillateeugeniceugenicsvacillationopeningpenitentphotogenichappeningpeninsulapenitencecynicismvilliimpenitent
Total 217, 30 Per page  3/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words