Sentencedict.com
 Directly to word page Vague search(google)
Home > Illicitly in a sentence

Illicitly in a sentence

  up(0)  down(4)
Sentence count:23Posted:2017-03-15Updated:2020-07-24
Similar words: illicittacitlyelicitsolicitimplicitexplicitfelicitypublicityMeaning: adv. 1. in a manner disapproved or not allowed by custom 2. in an illegal manner. 
Random good picture Not show
1. Those firms within the Community which employ labour illicitly will reduce their labour costs and gain a competitive advantage in production.
2. This could lead to prosecution of people who illicitly use passwords and codes to get access to forbidden parts of a system.
3. Anyone who steals, buys or illicitly supplies information of others' credit cards shall be punished in accordance with the preceding paragraph.
4. That substance illicitly to fool quality - inspection testers because it can mimic the properties of protein.
5. Because basically from smuggling and other assets illicitly acquired, will be handed over to Customs to auction.
6. They're low-key, homegrown blogs that don't host illicitly copied music, but do provide links to third-party sites, or storage lockers, such as Megashare, where pirated music is stored.
7. According to their account, their illicitly acquired mainly used to open, Internet and extended.
8. These designs reduce the problems of weapons-grade material being produced and sold illicitly .
9. She also suggested the twin towers were destroyed because they were outdated "money-suckers" that would've cost more to pull down that to illicitly destroy.
10. The bishop of Haimen diocese last week ordained five new priests, including three from Shantou diocese, where Father Joseph Huang Bingzhang was illicitly consecrated as a bishop three months ago.
11. Therefore, this approach to stem from the theft or misappropriation of public property illicitly acquired legalization become extremely easy.
12. There are already thought to be around 50,[sentencedict.com] 000 North Koreans living illicitly in China; the last thing Beijing wants is millions of refugees flooding across the border.
13. If the woman is subsequently promoted, her achievement will be undermined by office gossip that she earned it illicitly.
14. One worker told the NGO investigators that he was forced to sign a "confession letter" after illicitly using a hairdryer. In the letter he wrote: "It is my fault.
15. A regional news agency, PortAmur, posted some photographs and a grainy, low-quality video that appeared to have been shot illicitly.
16. Later in the book a group of criminals who have infiltrated a huge tetrahedral building make use of some illicitly obtained MGN—military-grade nano.
17. Graffiti is either "writing or drawings scribbled, scratched, or sprayed illicitly on a wall or other surface in a public place". Or!
18. For then Bernoulli (and mathematical economists from then on) proceeded to multiply mathematical convenience illicitly, by transforming his symbols into the new calculus form.
19. Until recently, though, lax enforcement has meant that foreigners working illicitly have been able to stay undetected for years.
20. Conclusion:This method has good sensitivity and specificity, and can screen the type of Antirheumatic traditional Chinese medicines with illicitly added chemicals rapidly.
20. Sentencedict.com is a online sentence dictionary, on which you can find excellent sentences for a large number of words.
21. The law innovated by creating an agency, known by its initials HADOPI, which would track abusers and cut off net access automatically to those who continued to download illicitly after two warnings.
22. Western governments international bodies should police Gaza's borders and crossing - points to stop weapons illicitly coming in.
23. They had already interviewed North Korean defectors living in China illicitly and said they wanted to document the smuggling route across the Tumen River which divides China and North Korea.
More similar words: illicittacitlyelicitsolicitimplicitexplicitfelicitypublicityduplicitycomplicitysolicitudefelicitatefelicitoussolicitouselicitationduplicitousfelicitationinfelicitousdeficitethnicitylubricityvilliidyllicmetallicfillipfill infall illcity slickerelectricitymilling
Total 23, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words