Sentencedict.com
 Directly to word page Vague search(google)
Home > Penicillin in a sentence

Penicillin in a sentence

  up(2)  down(0)
Sentence count:217+7Posted:2017-03-19Updated:2020-07-24
Similar words: illicitfill inillicitlywillingmillingspillingwillinglythrillingMeaning: [‚penɪ'sɪlɪn]  n. any of various antibiotics obtained from Penicillium molds (or produced synthetically) and used in the treatment of various infections and diseases. 
Random good picture Not show
91. Objective To evaluate the curative effect and side effect of the combined treatment with piperacillin sulbactam sodium and benzathine penicillin on primary and secondary syphilis.
92. There must be separate facilities and completely separate air handling systems for the production of penicillin as the CGMP regulations require for dosage form drug products.
93. Objective To probe the influence of mental interference on the result of Penicillin skin test.
94. Penicillin therapy is very effective on condition that the injections are given promptly on the hour.
95. The carrier of pink diatomite (6201), a kind of inorganic materials, was used to immobilize penicillin amidase.
96. Such diseases include: penicillin hypersusceptibility, bronchial asthma , allergic rhinitis, atopic dermatitis, food Anaphylaxis and so on.
97. When D-day arrived they have made enough Penicillin to treat all the wounded ally forces.
98. After afterwards penicillin, discovered streptomycin, chloromycetin, aureomycin to wait in succession again.
99. OBJECTIVE: To analyze and discuss the mechanism and influencing factors associated with epileptiform seizure induced by penicillin.
100. In 1928 Alec Fleming (now remembered as Sir Alexander Fleming) named the juice he extracted from some mold penicillin.
101. The bacteria, apart from bacteroides(sentence dictionary), are nearly all penicillin sensitive and crystalline penicillin with metronidazole are the antibiotics of choice initially until sensitivities are known.
102. Objective:To establish a method to identify quickly if the skin and muscular tissue of animals and human beings was injected with penicillin.
103. Since the rabbit's parent, one of my best friends, she still want to fight a little before surgery, we all want to know more about this Penicillin Gand save our rabbit from surgery.
104. Containment in a fermentor would meet this criterion and they are applicable to both dry and liquid state penicillin production.
105. Staphylococcus was highly resistant to penicillin, ampicillin, Oxacillin sodium, the first generation cephalosporins, and erythromycin.
106. Methods Used conventional intradermal subcuticular test and high speed allergy test instrument to take penicillin allergy test on children,[Sentencedict.com] then compared their response and recorded the data.
107. Object:Throngh mutagenesis and selection of producing xanthocillin, at last we improve the producing level of penicillin.
108. And bacterium of negative of change orchid family name is not sensitive to penicillin, and wait to streptomycin, chloromycetin sensitive.
109. Penicillin acylase was directly immobilized with glutaraldehyde as the crosslinked agent under the optimal immobilized conditions.
110. According to the drug sensitive test, Gbacillus was most sensitive to imipenem but its drug resistance to penicillin, cidomycin, cefalexin, clindamycin ect was more than 50%.
111. Prompt serology examination and penicillin treatment are the keys to cure ocular syphilis.
112. This paper is mainly about the determination of penicillin V potassium residue in milk by high performance liquid chromatography.
113. Numerous death have occurred from anaphylaxis after the injection of penicillin.
114. Blood samples were collected from the superior vena cava at different intervals after the drug was given. Serum levels of penicillin G were determined by microbiological method.
115. The design is penicillin factory with an annual output of 500 tons of the preliminary design.
116. Those pathogens were susceptible to ciprofloxacin and novobiocin, however resistance to penicillin C, streptomycin, bacitracin and polymyxin B was produced.
117. The S aureus showed less sensitive or tolerance to isatis root, tetracycline, gentamicin, pulsatilla chinensis, erythromycin, penicillin and so on.
118. Anaphylactic shock due to cefuroxime in a patient taking penicillin prophylaxis.
119. Zinc Bacitracin and penicillin, streptomycin, neomycin, chlortetracycline, colistin, which are synergistic antibacterial effect.
120. In sum, while the CGMP regulations would not prohibit decontamination and conversion, the difficulty of cleaning up penicillin residues makes the chore daunting.
More similar words: illicitfill inillicitlywillingmillingspillingwillinglythrillingfulfillingwillingnessunwillingnesspencildomicilepencil boxpencil casepenisvacillateoscillateeugeniceugenicsvacillationopeningpenitentphotogenichappeningpeninsulapenitencecynicismvilliimpenitent
Total 217, 30 Per page  4/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words