Sentencedict.com
 Directly to word page Vague search(google)
Home > Verify in a sentence

Verify in a sentence

  up(2)  down(10)
Sentence count:221+1Posted:2016-11-27Updated:2020-07-24
Synonym: authenticatecertifyconfirmcorroboratedocumentprovesubstantiatesupportvalidateSimilar words: clarifyterrifyingesterificationquaveringgive rise toimpoverishmentover and overrifleMeaning: ['verɪfaɪ]  v. 1. confirm the truth of 2. verify or regulate by conducting a parallel experiment or comparing with another standard, of scientific experiments 3. attach or append a legal verification to (a pleading or petition) 4. to declare or affirm solemnly and formally as true. 
Random good picture Not show
121. For example, if you select files to verify authority attributes, the GUI mines the owner, primary group, etc attributes for each file you selected.
122. In the annual audit of a company by a CPA firm, the independent auditors will verify receivables by communicating directly with the people who owe the money.
123. An approach of Micro program Controller design for coprocessor is put forward and a test bench is given to verify its function.
124. It occurs to many developers after authoring a few standard unit test functions that it would be better to move the call to verify from the test functions to the tearDown function.
125. To goto what President [ Ronald ] Reagan once said,'Trust, but verify.
126. The proposed Matrix Theory of interconnection function can be directly used to simulate. calculate or verify the experimental results of optical MINs with the sign of three dimensional interconnects .
127. OBJECTIVE : To test and verify the function of Composite Radix Sophora Flavescentis injection in immunologic enhancement.
128. Be sure to verify that no JVMs are running on the database machine before manually removing a database lock file.
129. Use stochastic simulation, create the plainness sequence of the stable stochastic road surface for the target road spectrums with programming, and use logistic test to verify.
130. You verify that Rolf's computer is connected to the network and that he did not cancel the invitation.
131. Bubba's software automatically attempted to verify that the signature was from Mike via the public directory.
132. The simulation results verify the high precision of the proposed compensation method regardless of the waveform of CT primary current, remanent flux level, and load characteristic.
133. Necessary cycle detection is added to avoid the singular matrix appearing after gross error compensation, . Simulation results verify the effectiveness of modified algorithm.
134. The practices verify that concrete has function of shielding strong ray. Thus the construction difficult issue how to efficiently solve cobalt 60 with strong radioactivity in construction is overcome.
135. The implementation and design of background system. Background is to deal with the Internet database to verify the identity of users, processing the data, which is sent by the clients.
136. Example: If the system is using even parity checking, verify the following code.
137. The Toolpusher or Senior Driller shall verify all stabilisers, reamers and bits will be gauged with appropriate ring gauge to ensure proper size before running in the hole.
138. Lynch told reporters that Iraqi and coalition forces would continue to analyze reports of violence and verify them on a case-by-case basis.
139. The theoretical analysis and digital simulation verify the feasibility of this method.
140. Objective:To verify the possibility of odontogenesis of bioengineered teeth from the cervical-loop structure of rat incisors in vivo.
141. The angle noise from the homing radar is the important random factor which has strong impact on the precision, it is essential to model and verify it.
142. The field loss test and simulative analysis are carried out on a simulative generation system and the experimental results verify the correctness of simulation results.
143. Jingbian Gasfield is a low-permeability gas reservoir with strong heterogeneity and it is difficult to verify its productivity.
144. To verify the proposed algorithms, a system-level simulation platform is built up and evaluated by the Monte Carlo method.
145. Simulation experiments are used to verify the validity of Aegis.
146. You can verify the active code page by typing chcp from the DOS prompt.
147. This paper applies linear viscoelastic theory to study on the creep and relaxation phenomena and to verify the relaxation behavior through several stress relaxation experiments.
148. Model checking based formal verification is a technique of this kind,(http://Sentencedict.com) and has been successful used in practice to verify complex sequential circuit designs and communication protocols.
149. In this paper, by using the single-chip microcomputer as a chronograph, we verify the law of conservation of momentum on air cushion guide, and give the relevant electric circuit and programs.
150. Please note that before providing a refund for any returned product we will first verify its condition. All Non-returnable items will neither receive refund nor return to you.
More similar words: clarifyterrifyingesterificationquaveringgive rise toimpoverishmentover and overrifledrifttriflethriftterrifichorrifiededifypacifyratifyvilifymodifytestifyjustifyqualifymortifyrectifygratifyspecifynullifyclarificationclassifyquantifyidentify
Total 221, 30 Per page  5/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words