Sentencedict.com
 Directly to word page Vague search(google)
Home > Verify in a sentence

Verify in a sentence

  up(2)  down(10)
Sentence count:221+1Posted:2016-11-27Updated:2020-07-24
Synonym: authenticatecertifyconfirmcorroboratedocumentprovesubstantiatesupportvalidateSimilar words: clarifyterrifyingesterificationquaveringgive rise toimpoverishmentover and overrifleMeaning: ['verɪfaɪ]  v. 1. confirm the truth of 2. verify or regulate by conducting a parallel experiment or comparing with another standard, of scientific experiments 3. attach or append a legal verification to (a pleading or petition) 4. to declare or affirm solemnly and formally as true. 
Random good picture Not show
211. Confirm that all ports are enabled, and verify that the CD-ROM Device is listed BEFORE the Hard-Disk Drive in the Boot Sequence list.
212. In the Support Info dialog box, verify the version number, and then click Close.
213. A checksum value, which is a simple mathematical computation used to verify that the packet arrived intact.
214. Special Audit Services:The special audit service is to investigate or verify any specific affair or situation for you or to meet any other requirements.
214. Wish you can benefit from our online sentence dictionary and make progress every day!
215. As the current tax system, but also everyone should not do tax returns , it is necessary to accurately verify the income will not be easy.
216. We implement and verify the DES circuit on behavior level and Register Transfer Level (RTL).
217. A very simple resistance network has been constructed to verify the conclusions arrived at.
218. The bank's responsibility is to verify that the explorer's documents conform to the letter of credit.
219. His identity certificate must be produced when handling the formalities and the futures company concerned shall check and verify his real identity by crosscheck .
220. Theoretical analysis applied game theory model and correlate analysis to verify conclusions about the influence of its variation on industrial concentration and product differentiation.
221. Here at the same time, electronic system level is designed (ESL) , producibility is designed (DFM) and test and verify also make the central point in the meeting.
More similar words: clarifyterrifyingesterificationquaveringgive rise toimpoverishmentover and overrifledrifttriflethriftterrifichorrifiededifypacifyratifyvilifymodifytestifyjustifyqualifymortifyrectifygratifyspecifynullifyclarificationclassifyquantifyidentify
Total 221, 30 Per page  8/8  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words