Sentencedict.com
 Directly to word page Vague search(google)
Home > Ceiling in a sentence

Ceiling in a sentence

  up(4)  down(5)
Sentence count:285+20Posted:2016-07-16Updated:2020-07-24
Antonym: floorSimilar words: boiling waterclingrulingrollingsiblingcompellingcounselingfulfillingMeaning: ['siːlɪŋ]  n. 1. the overhead upper surface of a room 2. (meteorology) altitude of the lowest layer of clouds 3. an upper limit on what is allowed 4. maximum altitude at which a plane can fly (under specified conditions). 
Random good picture Not show
181, The dining room has a beamed ceiling and a wood-burning stove within a stone fireplace.
182, When November came, and the debt ceiling had not moved, Rubin postponed catastrophe by borrowing from two government pension funds.
183, He raised his arm and touched the sloping ceiling above his head.
184, He straightened out, feet extended towards the ceiling, and rose into a handstand.
185, A first move is to abolish the national insurance ceiling on contribution.
186, She's lying on the bed, blowing smoke at the ceiling.
187, Instead of toning himself down, to broaden his appeal, he toned himself up, and hit his 30 percent ceiling.
188, The Osmenas had hung lengths of cloth from the ceiling in overlapping rows as sound baffles.
189, A dim light came from the single electric bulb in the ceiling of the room.
190, I do not believe that the Commissioners justified their proposal to raise the ceiling.
191, Clusters of tall, willowy bamboos rose out of ten pale-pink marble planters and almost touched the high triple-domed ceiling.
192, She gazed at the ceiling, feeling her heartbeat and breathing slowing to normal, her body quietening.
193, A top bunk was then pulled down from the ceiling, complete with ladder.
193, Sentencedict.com try its best to collect and build good sentences.
194, The room had roughly plastered walls and a low ceiling supported on enormous joists trimmed out of whole trees.
195, Chrissie glanced up towards the ceiling, then back at the note.
196, Q.. My recessed bathroom light extends through the ceiling into the unfinished attic, and it has no insulation around it.
197, In the bar, a single candle threw grotesque shadows across the ceiling.
198, It was pitch dark everywhere, and the whirr of the ceiling fan seemed to fill the silent bedroom.
199, He threw himself down on the huge old bed and stared at the sloping timber ceiling.
200, Import quotas may rise from the present ceiling of 18.5 million to 20 million.
201, As he moved the beam, the shadow of the grandfather clock in the hall twisted and grew across the ceiling.
202, The steel beam serves as a brace for the ceiling.
203, Swimming pool Bar Lounge Restaurant All rooms have balcony, ceiling fan and private facilities.
204, Most impressive, though, was what was hanging from the ceiling directly above the altar stone.
205, She looked up at the bedroom ceiling, where a pale stain recalled a burst pipe nearly fifteen months ago.
206, The books were housed in mahogany bookcases which covered the walls from floor to ceiling.
207, At night, the light of candles and hanging lamps rose into the darkness so the high beamed ceiling was barely visible.
208, Cherubim and seraphim frolicked along the borders of the ceiling and darted among blush-colored clouds.
209, Christina entered the hallway and switched on the ceiling fan.
210, The bedroom is wallpapered, both on walls and ceiling, with a delicate tiny pink flower motif on a white background.
More similar words: boiling waterclingrulingrollingsiblingcompellingcounselingfulfillingunsettlingwillingnesssurveillancereceiveperceiveconceivereceiverperceivedonce in a whileutilityabilityutilizefamiliarcivilianfacilitymilitarylinklinestabilityliabilitycall inblink
Total 285, 30 Per page  7/10  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words