Sentencedict.com
 Directly to word page Vague search(google)
Home > Thirteen in a sentence

Thirteen in a sentence

  up(1)  down(0)
Sentence count:236+9Posted:2017-04-09Updated:2020-07-24
Synonym: 13XIIIbaker's dozenlong dozenxiiiSimilar words: fourteenth amendmentshirtT-shirtteenteensthirdfifteenteenageMeaning: [‚θɜr'tɪːn /‚θɜː-]  n. the cardinal number that is the sum of twelve and one. adj. being one more than twelve. 
Random good picture Not show
(151) It met the wood in massive cylinders, thirteen feet across, made of inch-thick wrought-iron plates riveted together.
(152) An average light box is roughly twenty-four inches by thirteen inches and weighs less than ten pounds.
(153) He arrived in Virginia at the age of twelve or thirteen, perhaps as one learning seamanship.
(154) Thirteen demonstrators were killed when soldiers opened fire on the crowd.
(155) The latest redundancies bring the total number of job losses at the factory to thirteen hundred, in less than three years.
(156) Thirteen states are trying something similar to the medical savings accounts, he said.
(157) Read in studio A prison librarian who was held hostage in a cell for thirteen hours has been freed.
(158) I find Albert and Pearl in their bungalow,(sentencedict.com) which is shaded by the thirteen fruit trees out back.
(159) This left only thirteen railcoaches in original condition, plus the ten trailer towing cars.
(160) Thirteen families still have to be contacted, but hospital officials are confident they will be able to trace them.
(161) Chromosome numbers of thirteen iridaceous species from Zhejiang Province.
(162) In bridge, each player is dealt thirteen cards.
(163) The square of thirteen is one hundred and sixty-nine.
(164) The Appalachians run through thirteen states.
(165) "What time d'you make it?" — "Thirteen past.".
(166) Results: Thirteen clinical seizures were observed during EEG monitoring.
(167) When I was age thirteen, my father lost his store manager, a one-armed guy who could do more with his one arm than many will do with two.
(167) Sentencedict.com is a online sentence dictionary, on which you can find good sentences for a large number of words.
(168) The preliminary results of dense polycrystal particulate hydroxylapatite artificial bone grafting procedures in a group of thirteen residual maxillary alveolar cleft patients are reported.
(169) Ethan Allen became a hero of the American Revolution. But Vermont was not among the thirteen colonies that declared their independence from England in seventeen seventy-six.
(170) A legend still persists that she showed George Washington how to make a five-pointed star and suggested thirteen stars in a circle for the first flag.
(171) The pawnshop had sold the plates of his Flora after the expiration of thirteen months. Some coppersmith had made stewpans of them.
(172) Thirteen is an inauspicious number. No one like to live in that room.
(173) Methods We examined thirteen cases of syringoma using immunohistochemical staining for estrogen receptor(ER) and progesterone receptor(PR).
(174) A boy of thirteen followed, and Lota told the drivers it was the yong master.
(175) As the Five Classics during the Han Dynasty was the basis for the Thirteen Classics, so is the Pentateuch for the Bible.
(176) Over these thirteen days, we have learned that no one supports corporations' disproportionate influence in the political sphere.
(177) Symptomatic disease recurred in two of the thirteen hips treated with arthrotomy alone and in none of the hips that had undergone dislocation.
(178) She is baptize when she is a month old and confirm when she is thirteen.
(179) There are sixty-nine companies serving as add-in providers, and another thirteen associate member companies.
(180) From Anglo - Norman time to thirteen century, Britain was in aristocrat democracy time.
More similar words: fourteenth amendmentshirtT-shirtteenteensthirdfifteenteenagepreteenthirsteighteenteenagerthirstytwo-thirdsthirst forreparteethird reichthird worldthird partybloodthirstythrough thick and thinhiredirtchirpwhirlwhirrshirkskirtmirthdirty
Total 236, 30 Per page  6/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words