Sentencedict.com
 Directly to word page Vague search(google)
Home > Thirteen in a sentence

Thirteen in a sentence

  up(1)  down(0)
Sentence count:236+9Posted:2017-04-09Updated:2020-07-24
Synonym: 13XIIIbaker's dozenlong dozenxiiiSimilar words: fourteenth amendmentshirtT-shirtteenteensthirdfifteenteenageMeaning: [‚θɜr'tɪːn /‚θɜː-]  n. the cardinal number that is the sum of twelve and one. adj. being one more than twelve. 
Random good picture Not show
(211) Click here to download two PowerPoint decks, along with PDF documents, that depict the Certeon solution and how they used it for Energizer across a global WAN and in over thirteen countries.
(212) She finished her career in the Ladies Professional Golf Association with thirteen major victories.
(213) It was thirteen years since he had last seen her; she was fifty-three and he was seventy-one.
(214) Containing seventeen minerals and thirteen microelements, thermal spring has important functions of soothing skin,(sentencedict.com/thirteen.html) anti-allergy and reinforcing the natural protection screen for skin.
(215) I shall cross the seven seas and the thirteen rivers of fairyland.
(216) Thirteen strains of Riemerella anatipestifer isolated from ducks in China were serotyped by slide agglutination test, tube agglutination test and agar gel precipitation test.
(217) The ten are divided into thirteen parts for the sake of convenience.
(218) Methods : Thirteen sitting operation patients who received a central venous catheter aspirate air embolus were enrolled.
(219) Bozo washed his pictures off the pavement and counted his takings—it was about sixteen shillings(Sentencedict.com), of which he said twelve or thirteen would be profit.
(220) Thirteen behavior modification programs were conducted by the Department of Defense.
(221) According to the Object Management Group, UML 2.0 has thirteen different types of diagrams.
(222) The contents of writing are: Arabic numeral 0-9 and one sentence consisting of thirteen Chinesecharacters.
(223) Nag Hammadi is a village in Egypt,and in 1945, while they were digging for some clay and that sort of thing, an Egyptian peasant found thirteen large books.
(224) A boy of thirteen followed, and Lota told the drivers it was the young master.
(225) Thirteen ears were associated with outer and middle ear malformation.
(226) Thirteen of the bacteria species that the team identified are from a family known to break down cellulose, but seven of those species are unique to pandas.
(227) Thirteen months later, the strong-minded man thrilled the home crowd with strong comeback in Shanghai and proved he still had the strength to catch up with current record holder Dayron Robles of Cuba.
(228) The thirteen ugly G in Guangdong mahjong, if be in the hands of thirteen cards made up as follows, thirteen different Dan R, can be declared and used to winning, full ( ten times ) calculation.
(229) Now the command module of Apollo Thirteen headed alone toward Earth.
(230) A deck of cards has thirteen cards with hearts on them.
(231) Thirteen of these genes provide instructions for making enzymes involved in oxidative phosphorylation.
(232) If the baby is under thirteen weeks of age, a method known as Suction Curettage is used.
(233) Junipero Serra was born in seventeen thirteen on the island of Mallorca, Spain. After he became a Franciscan priest, he taught at a university in Mallorca.
(234) Even so, by the mid - thirteen hundreds, European paintings were depicting monks wearing eyeglasses.
(235) Traditionally, thirteen moon cakes were piled in a pyramid to symbolize the thirteen moons of a "complete year, " that is, twelve moons plus one intercalary moon.
(236) I should sail the seven seas and the thirteen rivers of fairyland.
More similar words: fourteenth amendmentshirtT-shirtteenteensthirdfifteenteenagepreteenthirsteighteenteenagerthirstytwo-thirdsthirst forreparteethird reichthird worldthird partybloodthirstythrough thick and thinhiredirtchirpwhirlwhirrshirkskirtmirthdirty
Total 236, 30 Per page  8/8  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words