Sentencedict.com
 Directly to word page Vague search(google)
Home > Clad in a sentence

Clad in a sentence

  up(4)  down(2)
Sentence count:219+5Posted:2016-12-28Updated:2020-07-24
Synonym: attiredSimilar words: gladbladesaladmaladyaccoladeclanclayclassMeaning: [klæd]  adj. 1. wearing or provided with clothing; sometimes used in combination 2. having an outer covering especially of thin metal. 
Random good picture Not show
121. The rest of the production includes a scantily clad nurse—the servers at the Heart Attack Grill are women clothed in sexy nurse outfits—and a voiceover disclaimer full of wit and jocularity.
122. Clad in a black lace negligee, Miss March, Lena Gornostayeva, wishes Putin a happy birthday with the message: "You put out the forest fires, but I'm still burning."
123. Peter Andre was all smiles as he performed surrounded by scantily clad dancers. But the singer had better watch out - his ex-wife Katie Price is threatening to 'expose' him.
124. I, clad in a cool summer nightie, and Grampy, his sleeveless T - shirt, sat watching the traffic.
125. Green though he was with seaweed, Samphire took his place beside the bride clad in white and was joined to her in matrimony.
126. Articles of jewellery and parts thereof , of precious metal or of metal clad with precious metal.
127. Lucy made being a '50 housewife chic, whether she was wearing an apron, clad in costume for one of her hijinks or dressed up for a night with Desi at Club Babalu.
128. That autumn has come, I stand on street, autumn, only felt scantily clad, empty, not by himself: Autumn in? He Laiqiu? How do not see autumn now?
129. The Master Bedroom suite is accessed via a polycarbonate clad stair tower that is by day a contemplative space and by night, a lantern.
129. Sentencedict.com try its best to collect and make good sentences.
130. Of course, there is never an iron clad guarantee that a paroled killer will never kill again.
131. Another is graft on surface , in which methyl methacrylate was introduced to clad nano - SiO 2.
132. The child was dressed as a National Guardsman, owing to the insurrection, and the father had remained clad as a bourgeois out of prudence.
133. Hastily she slipped off her wrapper and stood clad only in her chemise.
134. The characteristics and status quo on domestic and foreign metal clad sheet were briefly enumerated.
135. "I know you do, dear, but now it's time to show me just how much you do appreciate it, " as she hiked up her dress revealing stocking clad legs and garter belt with no panties! ! ! "
136. For exercise, try yoga and aerobics videos at home alone. You're not yet comfortable scantily clad in front of others.
137. A woman stood under the persimmon tree, clad in a hooded robe that brushed the grass.
138. The domestic vessel heads made of the exploded metal clad plates of B-3/304 hastelloy is less than developed countries because of the complicacy of fabrication.
139. Dalian Start metal material co. , Ltd is a company who is major on copper clad aluminum wire research, development and manufacturing. We are the one of most competitive manufacturing in China.
140. I'm looking for a small quantity (only 2 at the moment) of insulated copper clad aluminum wire for an electromagnet project.
141. Next, Judi Dench, playing costume designer Lily, appears clad in black and smoking a cigarette.
142. After his midday meal the Master went to the Panchavati wearing a beautiful yellow robe. Two or three Vaishnava monks were there,[sentencedict.com] clad in the dress of their sect.
143. At Adlerhorst, concrete bunkers emerged from the ground clad in traditional German half-timbering.
144. Many accounts attest to a somnambulist leaving their house clad only in underpants, or rising to cook a meal and returning to bed without so much as tasting it.
145. He was clad tonight in white tie and tails, a masculine fashion she had seen only in magazine illustrations.
146. He was a lovely boy, clad in skeleton leaves and the juices that ooze out of trees but the most entrancing thing about him was that he had all his first teeth.
147. But even five years ago, Chinese books and magazines were censored or banned from showing pictures of scantily clad models or publishing content that was deemed offensive or morally corrupt.
148. At Kim's Pyongyang residences, he's known for throwing lavish, all-night drinking parties for his top officials, usually including a bevy of scantily clad young women.
149. A ternary boride cermet clad material was fabricated on the Q235 steel substrate by means of the vacuum liquid phase sintering technique.
150. Hitler, clad in a long yellow shirt, had been chained to the stake.
More similar words: gladbladesaladmaladyaccoladeclanclayclassclaimclashdeclarea classdeclaredexclaveclarifyacclaimclassicclawbackproclaimclassifyclassroomclassicalproclaimedclandestineclassifieddeclamatoryclairvoyantmiddle-classneoclassicalclairvoyance
Total 219, 30 Per page  5/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words