Sentencedict.com
 Directly to word page Vague search(google)
Home > Bioassay in a sentence

Bioassay in a sentence

  up(0)  down(0)
Sentence count:48Posted:2017-11-08Updated:2020-07-24
Similar words: bioactiveassassinateassassinatedassassinationassassincharacter assassinationassaybiomassMeaning: n. appraisal of the biological activity of a substance by testing its effect on an organism and comparing the result with some agreed standard. v. subject to a bio-assay. 
Random good picture Not show
(1) The bioassay of freshwater sediment toxicity is described.
(2) The BOD test is essentially a bioassay procedure.
(3) Chronic bioassay tests indicate sublethal effects, such as changes in growth or reproduction of the organism over a longer period of time.
(4) Current bioassay methods include agar diffusion, algal and Lemna minor growth inhibition assays.
(5) A bioassay with branches of Japanese black pine (Pinus thunbergii Parl) to screen nematicides against pine wood nematodes (Bursaphelenchus xylophilus) was introduced in the paper.
(6) The bioassay of Cedrus deodara and three kinds of weeds from different family showed that the four toxins were not host specific.
(7) A bioassay test was conducted to examine the allelopathic effect of the sterilized seedlings on Chlamydomonas reinhardtii.
(8) The field bioassay of 4 trunk injection insecticides ( 14 % Imidacloprid + DDVP , 4.5 % Imidacloprid, 2 % Abamectin and 30 % DDVP + omethoate ) was conducted against < ...
(9) The Bioassay of rotenone and Tephrosia vogelii extracts aerosols to Culex pipiens quinquefasciatus(sentencedict.com), Blattellagermanica were researched with electron sprayer.
(10) And the bioassay showed they all have the function of restraining seed germination of Cryptomeria fortunei.
(11) Bioassay suggested that male response was regulated by the sex pheromone secreted by females.
(12) It has been found by bioassay that rice plant showed strong absorption action for imidacloprid.
(13) The bioassay of some compounds showed that they had moderate anti-TMV activity.
(14) The bioassay results of the narcotic ingredients of Celastrus angulatus against 8 species of insect pests showed that the ingredients had selective narcotic action.
(15) Laboratory bioassay and experiment in fields dorsalis ( Hendel ) were performed by the three kinds of matters.
(16) The role of bioassay method in study of relationship between insect and plant volatile as well as the biological significance of attraction of Pterocarya stenoptera to cotton bollworm were discussed.
(17) The results bioassay showed that the pheromonostatic factors existed mainly in the male accessory gland.
(18) A novel agar diffusion bioassay method for quantitative determination of mildiomycin was established.
(19) Insect bioassay results showed that these homozygous lines had significant inhibition to brown planthopper.
(20) The content of platelet activating factor in pancreatic tissue was determined using bioassay technique with washed rabbit platelets as described previously.
(21) Slow reaction substance of anaphylaxis(SRS-A) release from lung tissues of the sensitized guinea pigs after antigen challenge was examined by bioassay.
(22) The effects of aqueous extracts of hot pepper were determined by means of bioassay in laboratory.
(23) Based on the principle of Probit Analysis[Sentencedict.com], the Data Processing System For Pesticide Bioassay was established with EXCEL.
(24) Objective To observe the efficacy of natural pyrethrum mosquito coil against Culex pipiens pallens by bioassay.
(25) The aggregation behavior of oriental migratory locusts (Locusta migratoria manilensis) infected by Nosema locustae was studied using a behavior bioassay and an electroantennograph (EAG).
(26) The behavior of sulfate and mechanism of its inhibitory effect was studied under mesophilic condition with semi-continuous bioassay.
(27) The tetrodotoxin(TTX) concentrations in different tissues of wild and cultured Fugu obscurus were measured with mouse bioassay.
(28) This article is about the study on genetical toxical effects of five home made edible synthetic pigments by suing bioassay.
(29) Urinary luteinizing hormone (LH) was measured during two menstrual cycles of one adult female golden monkey using an improved in vitro bioassay method.
(30) This article is about the study on genetical toxical effects of five home2made edible synthetic pigments by suing bioassay.
More similar words: bioactiveassassinateassassinatedassassinationassassincharacter assassinationassaybiomasswassailvassalpass awayassailcassavaassaultpassagemassagemicroassemblyclass actpassablycassandrapassablemassacreassaultercassationjonas salkpass alongmassagistpassagewaysassafrasassailant
Total 48, 30 Per page  1/2  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words