Sentencedict.com
 Directly to word page Vague search(google)
Home > Bioassay in a sentence

Bioassay in a sentence

  up(0)  down(0)
Sentence count:48Posted:2017-11-08Updated:2020-07-24
Similar words: bioactiveassassinateassassinatedassassinationassassincharacter assassinationassaybiomassMeaning: n. appraisal of the biological activity of a substance by testing its effect on an organism and comparing the result with some agreed standard. v. subject to a bio-assay. 
Random good picture Not show
(31) Synergism of tebufenozide combined with Autographa californica nuclear polyhedrosis virus against Spodoptera exigua was studied by bioassay in laboratory.
(32) Bioassay showed that some of the title compounds had high plant - growth regulatory activity.
(33) Three bioassay procedures are described for comparing their sensitivities to chlorsulfuron in this paper.
(34) Having characteristic of high biological identification, DNA analytic technique has been became one of main methods of bioassay.
(35) Peripheral serum luteinizing hormone ( LH ) levels in rhesus monkey were estimated by in vtrio bioassay.
(36) The improved fluorescence microscopic bioassay with cells from callus of Pinus thunbergii was introduced.
(37) This study was aimed to establish a mouse bioassay for ciguatoxin detection.
(38) The toxic activities of 600 Bacillus thuringiensis strains isolated from soils and dead insects in China against Locusta migratoria manilensis were analyzed by using a virulent bioassay method.
(39) Preliminary bioassay showed that all of them possessed some extent herbicidal activity against Brassica campestris and Echinochloa crusgalli.
(40) A new insecticide bioassay target, green peach aphid, its rearing and several different bioassay methods were introduced in this paper.
(41) And the areas of application include emulsification, encapsulation, extraction, microreactor, mixing and bioassay.
(42) Objective To establish a bioassay of follicle stimulating hormone ( FSH ) in serum of rhesus monkey.
(43) The experiments show that Vigna radiate is an ideal bioassay material, and the seed vitality index, seedling root weight, and root length are perfect bioassay indices for the two bryophytes .
(44) The results of preliminary bioassay show that some of the target compounds have good in vitro activity against HSV-1 and excellent fungicidal activity.
(44) Sentencedict.com try its best to collect and make good sentences.
(45) Bioassay results revealed that mixed insecticide Jiaqing exhibited a significant synergism against oriental armyworm, bean aphid and rice leafhopper, and its cotoxicity coefficient (CTC) was 179.
(46) Corn was selected as the bioassay plant for the study of chlorsulfuron and metsulfuron methyl residue bioactivity in soils of typical agricultural areas of Jiangsu Province.
(47) Meth- od:Bioassay guided isolation was used to find out the monomeric compounds by carrying out the vitro anti - malaria assay on the fractions isola - ted from the MeOHextract of Semen Arecae.
(48) Effects of microorganism and environmental factors on persistence of acetochlor in soils were studied by bioassay using Echinochloa crusgalli.
More similar words: bioactiveassassinateassassinatedassassinationassassincharacter assassinationassaybiomasswassailvassalpass awayassailcassavaassaultpassagemassagemicroassemblyclass actpassablycassandrapassablemassacreassaultercassationjonas salkpass alongmassagistpassagewaysassafrasassailant
Total 48, 30 Per page  2/2  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words