Sentencedict.com
 Directly to word page Vague search(google)
Home > Yucky in a sentence

Yucky in a sentence

  up(2)  down(2)
Sentence count:25+1 Only show simple sentencesPosted:2017-07-13Updated:2020-07-24
Similar words: luckypluckyunluckykentuckyhappy-go-luckytackywackypickyMeaning: ['jʌkɪ]  adj. highly offensive; arousing aversion or disgust. 
Random good picture Not show
1. They painted the bathroom a yucky green colour.
2. The food was yucky.
3. I was fed up with the yucky mouldy silicone round the edge and reckoned a proper job should be done on it.
4. Jake didn't watch the yucky parts where Kull kisses girls.
5. The food in the restaurant is yucky.
6. No, I don't. They're yucky.
7. Dad frowns and says, "No, I think it's yucky.
8. The food served in this canteen tastes yucky.
9. The food in the school cafeteria is yucky.
10. Dad frowns and says, "No, I think it's yucky. Why do you ask me this question? It's a silly question."
11. Girls generally thought this yucky(sentencedict.com), but some boys thought it was pretty neat.
12. Arch Deluxe ads showed kids making "yucky faces, " turning up their noses at the new adult burger.
13. Chef Tony Says: Be frugal! Use the yucky orange-colored oil when cooking for children or those with a severe head cold.
14. Tackle the yucky stuff and you should be able to detox it out of your life.
15. Use the yucky orange-colored oil when cooking for children or those with a severe head cold.
16. Dad frowns and says, No, I think it's yucky . Why do you ask me this questions?
17. Just like you thought French kissing was yucky when you first heard it described, don't change your mind about oral sex either.
18. They also made very similar faces when they were shown some yucky photos: pictures of dog poop or dirty toilets.
19. I found a lot of the imagery to be rather yucky and scary.
20. Would I go for somebody that the others consider is yucky, whatever you call it nowadays, yucky?
21. Then he opens us, connecting deep inside to scoop out all the slimy, yucky stuff, including seeds of doubt, spite, lies(Sentencedict), and fear.
22. Everyone knows someone who refuses to eat certain foods, whether it's because of yucky texture, unappetizing color or stinky smell.
23. You did get a mouthful of paper towels, cotton balls, dish soap, plus other yucky surprises.
24. People may tell you it's important to have specific financial goals, but when you try to do this for yourself, it makes you feel yucky inside.
25. A chelating agent that softens hard tap water by binding with dissolved metal ions, preventing them from being deposited as a yucky residue on your nice clean dishes.
More similar words: luckypluckyunluckykentuckyhappy-go-luckytackywackypickycockyrockystockytrickystickywhackyfinickypanickycolickybackyardpuckfucksuckhuckruckmucktuckduckbuckluckpluckstuck
Total 25, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
  • Esteban 2023-02-28 17:29:51
    .                                                                                                                            .                                                                                                                            hola .                                                                                                                            .                                                                                                                            mis amigos                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                        
  • Leo 2023-02-24 16:03:08
    .                                                                                                                            .                                                                                                                            Good morning                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                             
  • Marcos 2023-02-24 03:49:31
    .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                           
  • Angelita 2023-02-23 21:50:37
    .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                           
  • Grace 2023-02-23 16:57:49
    ∞                                                                                                                            ∞                                                                                                                            . ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                         
  • Angelita 2023-02-23 16:54:38
    ∞                                                                                                                            ∞                                                                                                                            . ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                         
  • Angelita 2023-02-23 08:01:09
    ∞                                                                                                                            ∞                                                                                                                            . ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                         
  • ● WARNING 2023-02-22 15:40:56
    .                                                                                                                            .                                                                                                                            I ♥ PonyExpress. It's much better than sentencedict.com ●                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                   
More words