Sentencedict.com
 Directly to word page Vague search(google)
Home > Weaken in a sentence

Weaken in a sentence

  up(1)  down(5)
Sentence count:160+1Posted:2016-07-21Updated:2020-07-24
Antonym: strengthenSimilar words: take note oftake notice ofspeakerweekendwearswearweavewear offMeaning: ['wɪːkən]  v. 1. lessen the strength of 2. become weaker 3. destroy property or hinder normal operations 4. reduce the level or intensity or size or scope of 5. lessen in force or effect. 
Random good picture Not show
61. In other ways the activities of the councils tend to conflict with regional policy and weaken its effects.
62. The Supreme Court is expected to weaken further the nationwide constitutional protection for abortion early next year.
63. Still, they encouraged conservative members to introduce amendments that would weaken the impact of an increase on business.
64. Pleasure, a rarity at any rate, only serves to weaken one; what one really needs is stamina and discipline.
65. On the other hand, failure to make any apparent headway towards regaining the West Bank threatened to weaken the regime domestically.
66. We tend to pursue goals that weaken our will and clog up our view.
66. Wish you can benefit from our online sentence dictionary and make progress day by day!
67. Despite the attempt to treat the Pythagorean example as an exception, it can not but weaken Goody's case.
68. What is interesting is that the brush-off did not weaken her resolve or deflect her from her mission.
69. Believe in naturalism and you weaken your view of prayer.
70. From my own point of view, I should be prepared to weaken the requirements of the Turing test very considerably.
71. Many fear that the flood of imports could weaken Britain's economy.
72. Weaken, turn your back for a moment and it could be lost for good.
73. He had been put on trial in May 1991, in what was seen as an attempt to weaken the nationalist opposition.
74. He knows Clinton will not propose and Congress will not enact legislation to seriously weaken provisions of the new law.
75. Military officials had argued that to do so would weaken unit cohesion and lower morale.
76. The time is ripe for an attempt to weaken his position.
77. Factional infighting have weaken the party structure.
78. To deprive of strength or vigor; weaken.
79. We never weaken our efforts in face of difficulties.
80. To deplete or weaken gradually; devitalize.
81. Oil-based lubricants such as petroleum jelly (vaseline), cold cream,(Sentencedict.com) hand lotion or baby oil can weaken the latex condom and are not recommended.
82. Israel has intervened even more forcefully to weaken the shekel.
83. Results: The results showed that the effusion of the middle ear decrease the amplitude of stapes footplate and umbo, weaken the incoming energy of the inner ear, thus leading to hearing loss.
84. When metal substrate and the coating are heated or cooled there would cause remanent stress to weaken the adhesive strength between them on account of their various expansion coefficients.
85. In fact the constitution of 1787 set out to do the opposite: to bolster the centre and weaken the power the states had briefly enjoyed under the new republic’s Articles of Confederation of 1777.
86. The electromagnetic damper studied in this paper belongs to a special kind of coreless generator, which is used for the energy absorption and dissipation in order to weaken vibration.
87. When Mercury goes out of phase for three-and-a-half weeks every 12 weeks, these areas weaken and go haywire.
88. Ideally they want to plants the banderillas as close as possible to the wound where the picador drew first blood. These stabs further weaken the enormous ridges of neck and shoulder muscle.
89. Children disorders: restless syndrome, infantile autism, weaken in intelligence, poor develop.
90. Stocks close sharply lower as investors worry that the economy is poised to weaken even as frozen credit markets slowly start to show signs of recovery.
More similar words: take note oftake notice ofspeakerweekendwearswearweavewear offwear outwealthsweaterwealthypeaksteakbreakspeaksneakstreakbreak offbreak upbreak inbreak outspeak upspeak forbreak downbreak awayso to speakbreak intoto speak ofbreak through
Total 160, 30 Per page  3/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words