Sentencedict.com
 Directly to word page Vague search(google)
Home > Rich in a sentence

Rich in a sentence

  up(12)  down(7)
Sentence count:152+70Posted:2016-12-29Updated:2020-07-24
Synonym: aboundingaffluentcomfortablecostlyelegantexpensivefertileflavorfulopulentpricelessproductiveprolificprosperousvaluablewealthywell-to-doAntonym: poorSimilar words: enrichwhichsandwichdichotomyEricricepricebrickMeaning: [rɪtʃ]  n. people who have possessions and wealth (considered as a group). adj. 1. possessing material wealth 2. having an abundant supply of desirable qualities or substances (especially natural resources) 3. of great worth or quality 4. marked by great fruitfulness 5. strong; intense 6. very productive 7. high in mineral content; having a high proportion of fuel to air 8. suggestive of or characterized by great expense 9. containing plenty of fat, or eggs, or sugar 10. marked by richness and fullness of flavor 11. pleasantly full and mellow 12. affording an abundant supply. 
Random good picture Not show
121. The rich man lives in luxurious surroundings.
122. With urbanisation the antagonism between rich and poor sharpened.
123. His voice had a rich melodic quality.
124. Soybeans are very rich in protein.
125. The family are rich, and extremely sophisticated and cosmopolitan.
126. She was rich, beautiful and seemingly ageless.
127. Each sentence seems a quarry of rich meditations.
128. The plan provided for the rich to assist the poor.
129. He was from the same mould as the men she had gazed at worshipfully when a child: rich, handsome, of impeccable social standing.
130. Coincident interests with the corporate rich and political directorate are pointed out.
131. Mr Rich will be writing a twice-weekly commentary on American society and culture.
132. Gil says that women can't keep secrets. That's rich, coming from him, the professional sneak.
133. These two buildings typify the rich extremes of Irish architecture.
134. That lovely, rich fragrant smell of the forest enveloped us.
135. The plates were all edged with a rich border of gold.
136. The emperor was clad in a rich robe encrusted with jewels.
137. His novels are a rich synthesis of Balkan history and mythology.
138. Don't indulge in rich sauces, fried food and thick pastry as these are high in fat.
139. You won't be rich as an MP, but you'll have enough to live on.
140. It is made with fresh minced meat, cooked with onion and a rich tomato sauce.
141. The film is a rich brew of adventure, sex and comedy.
142. My desire to be rich was an insane, unwholesome, oppressive desire.
143. Over the same period trade protection has increased in the rich countries.
144. The resort is a playground of the rich and famous.
145. The studio was filled with the rich odour of roses.
146. Only the extremely rich could afford to lunch at the Mirabelle.
146. Wish you can benefit from sentencedict.com and make progress everyday!
147. Rich Italian clubs such as AC Milan cannot simply skim off all of Europe's stars.
148. Visitors can view a rich and colorful array of aquatic plants and animals.
149. The sun - dried tomatoes give the dish a wonderfully rich flavor.
150. He found he had struck it rich when he unexpectedly inherited some money from his aunt.
More similar words: enrichwhichsandwichdichotomyEricricepricebricktrickrubricstrictfabricAfricanlyricsAmericantricepsauriclehistoriccapricericketsavaricetricyclemeteoricstrictlyhurricanetrickeryelectricrestrictdistrictprice tag
Total 152, 30 Per page  5/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words