Sentencedict.com
 Directly to word page Vague search(google)
Home > Penicillin in a sentence

Penicillin in a sentence

  up(2)  down(0)
Sentence count:217+7Posted:2017-03-19Updated:2020-07-24
Similar words: illicitfill inillicitlywillingmillingspillingwillinglythrillingMeaning: [‚penɪ'sɪlɪn]  n. any of various antibiotics obtained from Penicillium molds (or produced synthetically) and used in the treatment of various infections and diseases. 
Random good picture Not show
121. For the treatment of group A streptococcus infection. the clinical doctor should choose penicillin, oxacillin and cephalosporins first.
122. Alternatively sows can be injected with long - acting penicillin at point of farrowing.
123. Scottish bacteriologist who in 1928 discovered the first antibiotic substance, penicillin, but without isolating it.
124. This paper presents a measuring system of the concentration of penicillin with DSP based on the theory of ISFET.
125. Conclusion The combination of penicillin and percussopunctator plus cupping jar is effective for the treatment of erysipelas on Lower legs and prevention of recurrence.
126. Penicillin and sulphanilamide compound are used jointly, streptococcic to mucky bowel coccus and oxygen of be disgusted with infection can enhance curative effect.
127. The first three positions were filled by medical inventions or discoveries, the X-ray machine being followed by the discoveries of penicillin and the DNA double helix structure.
128. Among the Bacteria susceptible to penicillin are those causing strep throat, spinal meningitis, gangrene, and syphilis.
129. Why don't you get your plastic baggie and dig up some penicillin?
130. Objective:Decide on a suitable dissoluble oxygen condition of penicillin fermentation.
131. Localization of activity of immobilized penicillin G acylase was studied by X ray microanalysis.
132. The advances in immobilized acetylase of penicillin and process of enzymatic condensation in cephalexin synthesis were reviewed.
133. Objective To improve the stability of penicillin V potassium tablets,(Sentencedict.com ) and extend the pharmaceutical product's term of validity.
134. Penicillin and other antibiotics were miracle cures for gonorrhea and syphilis. The poor, humble condom languished.
135. In 1967 there were the first report of pneumococci that were relatively insensitive to penicillin and by 1981, there were cases of multiple drug resistance.
136. The results showed that antagonist of muscarine receptor—scopolamine could retard, but not completely block epileptiform discharges induced by penicillin.
137. Sir Alexander Fleming did not, as legend would have it, look at the mold on a piece of cheese and get the idea for penicillin there and then.
138. Enzyme Inhibition INTRODUCTION Almost all therapeutic drugs are enzyme inhibitors, from old medicine box standards such as aspirin and penicillin to the newest compounds used to treat HIV infection.
139. Activity andstability of immobilized glucoamylase and penicillin acylase were studied.
140. Sir Alexander shared the 1945 Nobel Prize in Physiology or Medicine with Ernst Chain and Sir Howard Florey for the discovery of penicillin and its curative effect on infectious diseases.
141. Penicillin is made up of plant material that the body can absorb.
142. Objective : To compare among ceftriazone, penicillin, and ciprofloxacin in the treatment of lower respiratory tract infection.
143. These two patients received benzathine penicillin injection for treatment and got improvement of their ocular changes.
144. The organism may not be penicillin sensitive, so flucloxacillin is the drug of choice.
145. Penicillin V potassium salt is oxidized with Peracetic acid to synthesize Sulfoxide with a yield of 96.1%.
146. The preparation of penicillin G sulfoxide p-nitrobenzyl ester from penicillin G was studied.
147. Penicillin is arguably the greatest medical discovery of the twentieth century.
148. An endophytic fungus resistance to penicillin was isolated from Hyacinthus orientalis by culturing on a preliminary screening medium and it vitro cultured and its anti-microbial activity was detected.
149. Yaws can be treated with a single dose of a cheap and effective antibiotic: Benzathine Penicillin injection cures the disease.
150. Erythromycin is a macrolide antibiotic often used in children with minor bacterial infections, especially in those with an allergy to penicillin.
More similar words: illicitfill inillicitlywillingmillingspillingwillinglythrillingfulfillingwillingnessunwillingnesspencildomicilepencil boxpencil casepenisvacillateoscillateeugeniceugenicsvacillationopeningpenitentphotogenichappeningpeninsulapenitencecynicismvilliimpenitent
Total 217, 30 Per page  5/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words