Sentencedict.com
 Directly to word page Vague search(google)
Home > Flake in a sentence

Flake in a sentence

  up(7)  down(3)
Sentence count:143+3Posted:2017-02-17Updated:2020-07-24
Synonym: bitchipeccentriceccentric personflake offfleckgeekoddballpeelpeel offscrapsnowflakeSimilar words: flakessnowflakeflamflagflatflaskflashflairMeaning: [fleɪk]  n. 1. a crystal of snow 2. a person with an unusual or odd personality 3. a small fragment of something broken off from the whole. v. 1. form into flakes 2. cover with flakes or as if with flakes 3. come off in flakes or thin small pieces. 
Random good picture Not show
(121) As the hair fiber ages and gets weathered by exposure to pollution and through washing so the cuticle layer loses its shiny appearance and the cuticle scales flake away from the hair shaft.
(122) At last, according to the design method of DW, in actual application of Zhejiang Province floating population information system, we establish DW of the snow flake schema.
(123) These flake graphite are as perpendicular as fiber axis photograph on orientation.
(124) One flake and then another, and the deepest snow is laid.
(125) The glue solution is made by using 8.5 ounces of flake hard glue.
(126) The traditional non-solvent epoxy glass flake coating was modified by self-made electroless Ag flake graphite and the glass flake conductive coating was prepared.
(127) Then a large flake of silcrete almost 10 centimetres in diameter was found embedded in ash in an ancient fire pit.
(128) The laser hardening microscopic structures are mainly very fine martensite and the original pattern of flake graphite basically remain.
(129) The ceramic layer does not crack or flake off when heated to 800℃ and then quenched.
(130) Calculation result demonstrates consumption for preparing micron flake wood fiber is low.
(131) Snow - flake of street fluttering because of son , the sad beauty gather.
(132) To protective material used in surfacing and finishing flake off.
(132) Sentencedict.com is a online sentence dictionary, on which you can find nice sentences for a large number of words.
(133) Cutter base do with pyrocondensation. Elegant in design. Suitable for recycle and restore of flake plastics. Conventional flake crusher adopts airtight bearing to allow long time rotation.
(134) Specific Property: Magnesium chloride is a white or brownish yellow, flake or granular crystal. It tastes bitter and is easily deliquesces.
(135) Hexanediol is a waxy solid or flake. When formulated with water, the reaction is endothermic and one might need to warm the solution to effect complete dissolution at high levels of supersaturation.
(136) Epoxy glass flake coating and daub offers excellent anti-permeability and corrosion resistance. They are small in residue stress and easy in construction.
(137) The properties of the epoxy glass flake coating and daub and construction were detailed.
(138) Skin of one flake lemon is baked with microtherm in boiler, not only but the peculiar smell with indoor eliminate, and still can make indoor fragrance tangy.
(139) The comparison the stainless steel flake with the PIF in different way give more reference in roundly knowing the properties of PIF.
(140) We want to buy 2x20fcl 40-50mt Flake graphite . Just producers can be contact with us.
(141) It is mainly used for transparent film and flake, imitation leather, cable granule, rigid material, etc.
(142) Sakers and aspirators separate the hull from the cracked cotyledons and rollers flake them.
(143) Therefore, as a metallic pigment supplier, we offer a new range of aluminium flake silver dollar type of products using water-milling technology.
More similar words: flakessnowflakeflamflagflatflaskflashflairflameflankflavorflat outflare upflawedflatterinflateflaccidflawlessdeflatedinflamedflagshipflaggingafflatusdeflationflash backrule of lawinflationflatteringflagellatecamouflage
Total 143, 30 Per page  5/5  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words