Sentencedict.com
 Directly to word page Vague search(google)
Home > Craig in a sentence

Craig in a sentence

  up(0)  down(0)
Sentence count:187Posted:2017-04-09Updated:2020-07-24
Similar words: arraignstraightstraightenstraightawaystraighten upstraight linestraightforwardkeep a straight face
Random good picture Not show
121. The likes of Jack Wilshere, Craig Eastmond and Fran Merida have made notable contributions but, at present, they remain on the periphery of the first team.
122. Rami Shaaban and Stuart Taylor are also also out, so 18-year-old goalkeeper Craig Holloway takes his place on the bench.
123. Craig Venter said that the discovery would make patents on single genes less useful.
124. "I headed down to the club and within about 15 minutes of the call-out we had the inflatable in the water, " said Craig Van Tenac, a local lifeguard on the scene.
125. Craig Fritz began his career as a photojournalist at the Santa Fe New Mexica and was a finalist in William Randolph Hearst Foundation Journalism Awards.
126. Brian studies eating habits at Cornell, while Craig is a religion professor at Virginia Wesleyan. Which puts them at the head of the table for this research effort.
127. Craig Snell of the Met Office said that temperatures would fall again in most parts of the country tomorrow and Wednesday.
128. It couldn't: Bond portrayer Daniel Craig made the list for the second year in a row.
129. The study, published in Britain's International Journal of Obesity, is co-authored by Wansink's brother, Craig, a Presbyterian minister and professor of religious studies at Virginia Wesleyan College.
130. President Obama's NLRB under chairman and former union lawyer Craig Becker surely earns that distinction.
131. This week's spate of U. S. twisters is being compared to the "super outbreak" of tornadoes on April 3 and 4, 1974, U. S. Federal Emergency Management Agency administrator Craig Fugate told CNN.
132. U. S. geneticist Craig - Infante said that he has found a way to replace the "petro-chemical industry" technology.
133. "Our research showed that the problem would be in storm surges that occur at high tide, " says Craig Hartman, design partner in SOM's San Francisco office.
134. Craig, Obama's sparring partner lined up for Tampa, was a stand-in for President George Bush while John Kerry prepared for the 2004 debates.
135. Craig Dietz, a US man born armless and legless, took part in a swimming competition in Pennsylvania recently with the help of a manmade caudal fin and finished 275th out of 308 participants.
136. Mr. Craig had been proud to show his taste and his hothouse plants on the occasion.
137. Craig is expected to make his official announcement Saturday during a press conference in Boise.
138. Craig: Do you think this position is a good fit for Rebecca?
139. Craig Bellamy and Steve Finnan were rested but will return to the squad along with Sami Hyypia for the trip to PSV.
140. "This is becoming a grindingly familiar pattern with strength in wireless and weakness in wireline," said Sanford C. Bernstein analyst Craig Moffett.
141. Wilson Craig said "The eradication of the fixed workplace and the complete disintermediation of information. Doing away with major networks, newspaper".
142. "It just seemed like it was back-to-back and it came in waves, " said Craig Fugate, who heads the US Federal Emergency Management Agency.
143. Craig Currier, the superintendent, who I call my "young superstar, " said that once people played it, they were amazed at the conditioning, as well as the design.
144. Uncle Craig assumes the crash position if talking on his cellphone and another call arrives.
145. Craig Venter 's tremendous and brilliant attempt to DNA sequence things in the ocean is great.
146. For example, Craig is a C-3 quadriplegic completely paralyzed, he can only move his head.
147. While Craig made major changes to the masts and sail plan, the girls focused on the woodwork,(sentencedict.com/Craig.html) with Tracy learning how to use a table saw and Sara applying a 12-coat marine finish.
148. One pioneer of genetic deconstruction Dr. J. Craig Venter agrees with Dr. Raven.
149. Cross-selling has been an effective tool for Craig Zimmer, president of MobilePC (eBay User ID: mobilepc) in San Diego.
150. Craig of USDA's Agricultural Marketing Service for preparing the illustrations, and to L.A. Risse of USDA's Agricultural Research Service for reviewing this publication.
More similar words: arraignstraightstraightenstraightawaystraighten upstraight linestraightforwardkeep a straight facebrain draintaigacampaigncramcrapraidrainrailcrawlcratecranecrasscrazecrazyscrapcravecrashcraftcrackcramprainybrain
Total 187, 30 Per page  5/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words