Sentencedict.com
 Directly to word page Vague search(google)
Home > Leakage in a sentence

Leakage in a sentence

  up(1)  down(2)
Sentence count:186+3Posted:2017-02-28Updated:2020-07-24
Synonym: escapeleakoutflowSimilar words: break awayunspeakablepackageblockagepackage tourthe dark agesbleakmileageMeaning: ['lɪːkɪdʒ]  n. the unwanted discharge of a fluid from some container. 
Random good picture Not show
(121) Results:The free gas in variable location, shape and size was seen in 24 cases, and the leakage of contrast medium in 3 cases, as well as the encapsulation in omental bursa in 2 cases.
(122) In order to solve the problem of reducing spectrum leakage, a new algorithm based on equal angle-interval sampling principle is proposed according to the cyclic shift character of base phasor.
(123) Experimental results show that this circuit status difference based genetic algorithm can achieve satisfied leakage power reduction, and runtime is reasonable.
(124) The leakage impedance of a high leakage impedance transformer is analyzed. Its formula is derived. The test examination of this formula is made.
(125) The study on the leakage and diffusion of the hazardous material (HazMat) is the base of emergency management.
(126) Using free autogenic fat and ebonite to repaired the sellar floors in case of CSF leakage during surgery is a effective measurement.
(127) In this article, the reform of the flange joint at the bottom of LPG tank was introduced, and the methods to remove leakage were discussed as well.
(128) Consequently, the identification and modeling of different leakage components an very important for estimation and reduction of leakage power,[sentencedict.com] especially for low power applications.
(129) Results The 28 patients have not anastomotic leakage, anastomotic stenosis and esophageal reflux.
(130) Our products adopt OMICRON plug connection patent and use stainless steel main water tubes as well as stainless steel connection screws, solving the water leakage problem of the radiators.
(131) Special deign is the maze - design subassembly to prevent leakage.
(132) By analyzing for the flange leakage on a heavy oil catalytic pyrolysis unit, the writer put forward a treatment method, i. e. to replace old asbestos gasket with a compound corrugated gasket.
(133) Finally, our simulation result shows that conventional SOI SBSD-MOSFET can effectively suppress thermionic emission leakage current, but it still can not suppress tunneling leakage current.
(134) This paper states some common fault and prevention measures of architecture external wall leakage.
(135) Based on full current theory, derive formula of slot leakage reactance from magnetic field energy calculation.
(136) Test method for total inward leakage of filtering particle respirator.
(137) Methods:The bactericidal mechanism of plasmas ozone against E. Coli on the surface was studied through observing change of ultramicrostructure, break of DNA double-strands and leakage of proteins.
(138) Downstream rotor-stator interaction increases the unsteady fluctuating intensities of the rotor tip clearance flow and the tip leakage loss.
(139) Causes and treatment of bile leakage ( a report of 22 cases ).
(140) For photoflash, lug type,[http://sentencedict.com/leakage.html] low loss factor and low leakage current.
(141) Your doctor may recommend bed rest if aortic enlargement or aortic valve leakage occurs.
(142) To study the influence of rotary inertia on gear flowmeter natural frequency, keep damping and leakage coefficient as constant.
(143) Thus we got the table of the specific leakage distance required for the sites with different pollution severity in the high altitude regions.
(144) All tanks are oversized to allow for leakage, temperature changes and condensation.
(145) It points out the problem that should be paid attention to in designing transformer and the measure to reduce leakage inductance.
(146) Trapped charge buildup during irradiation in buried oxide , which dominantly induces back channel leakage, is investigated.
(147) The marginal propensity to import, in other words, is a " leakage " from the expenditure stream.
(148) Surface leakage is across the surface of the material, usually due to contamina?tion such as flux or salts and other chemicals from fingerprints .
(149) The next most important complication of gastric surgery is leakage at a suture line.
(150) The SourceMeter instrument first performs the necessary DC tests, such as forward voltage, reverse breakdown voltage, and leakage current.
More similar words: break awayunspeakablepackageblockagepackage tourthe dark agesbleakmileagepeakweakbeakbreakfreakwreakspeaksteaksneakweakenfreakystreakbespeakoutbreakspeak forbreak offbreak inspeak upspeak outbreak outspeakerbreak up
Total 186, 30 Per page  5/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words