Sentencedict.com
 Directly to word page Vague search(google)
Home > Crackling in a sentence

Crackling in a sentence

  up(2)  down(3)
Sentence count:63Posted:2017-07-14Updated:2020-07-24
Similar words: tacklingcracklecracklyticklinghecklingbucklingducklingsucklingMeaning: ['kræklɪŋ]  n. 1. the residue that remains after animal fat has been rendered 2. the sharp sound of snapping noises. 
Random good picture Not show
31. The telephone line from San Antonio to Boston is crackling with the static of an ideological rift.
32. The wooden beams and ceiling were crackling in the extreme heat.
33. Behind them rose plumes of steam lit from below by the crackling death of his amps.
34. He sprawls across it and shudders like his back's broken, and there's a crackling noise like sizzling fat.
35. And soon the word was crackling over the telegraph wires to all parts of the North.
36. Benjamin heard the faint crackling in the undergrowth but took one look at me and gave up any idea of pursuit.
37. Folly's practised eye assessed the hothouse blooms in their crackling cellophane wrapper.
38. Crepitate :To make a crackling or popping sound; crackle.
39. The firecrackers were crackling and spluttering.
40. He is trying out chicken fat for crackling.
41. We found the thunder set the radio crackling.
42. Summer nights mysterious with crackling stars!
43. To roast or calcine until they emit a crackling sound or until crackling stops.
44. To roast or calcine (crystals or salts) until they emit a crackling sound or until crackling stops.
45. All we can hear is an indistinct crackling(Sentencedict.com), bubbling and hissing.
46. The atmosphere is crackling - both men are hitting maximums for fun and Davies is starting to look very confident.
47. Singles are friendly, outgoing and very social, however once couple up, you prefer to spend long evenings at home gazing into a crackling fire and sharing your plans for life.
48. A cheerful wood fire was crackling in the sitting room.
49. These abandoned gods, exiled in outdoor environments, reveal crackling paint, tangled beards and fractured skulls.
50. Stephen closed his eyes to hear his boots crush crackling wrack and shells.
51. You has heard the sound of crackling , etc. sound?
52. Random noise, such as crackling in a receiver or specks on a television screen, produced by atmospheric disturbance of the signal.
53. Their crackling bad humour left them, but the heaviness of their spirit remained.
54. There are slight crackling sounds when we take off our clothes in winter.
55. It is pretty certain that you have heard a soft crackling noise.
56. Outside, the gale howled and drove the rain against the window in a crackling fury.
57. Ronald Wilson Reagan stood at a lecture before a crackling StateRoom of the White House.
58. Subsets of noise are AC power-related hum and buzz, electronic crackling, vinyl record clicks and pops, between-station radio noises, tape modulation noise, and the triboelectric cable effect.
58. Sentencedict.com try its best to gather and make good sentences.
59. Old Peter threw in the lighted sticks and charcoal, and made a draught to draw the heat, and then set the samovar on the table with the little fire crackling in its inside.
60. Only one knight remained now, and he circled warily as the two warlocks hurled bolts of crackling purple-black darkness at Kejira.
More similar words: tacklingcracklecracklyticklinghecklingbucklingducklingsucklingpricklingtricklingswashbucklingcrackingblacklistblack listnecklinecrackcrackercrackedcrackdowngimcrackcrackpotwisecrackcrack a jokecrack of doomfirecrackerinklingweaklingdarklingtinklingsparkling
Total 63, 30 Per page  2/3  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words