Sentencedict.com
 Directly to word page Vague search(google)
Home > Crackling in a sentence

Crackling in a sentence

  up(2)  down(3)
Sentence count:63Posted:2017-07-14Updated:2020-07-24
Similar words: tacklingcracklecracklyticklinghecklingbucklingducklingsucklingMeaning: ['kræklɪŋ]  n. 1. the residue that remains after animal fat has been rendered 2. the sharp sound of snapping noises. 
Random good picture Not show
61. Almost before he knew it, he was astern, swimming gently on the foam - crackling surface.
62. Crepitus is a clinical symptom in medicine that is characterized by a peculiar crackling, crinkly , or grating feeling or sound under the skin, around the lungs, or in the joints.
63. Pride of place goes to a diorama showing former serfs merrily chucking "feudal documents" into a crackling fire.
More similar words: tacklingcracklecracklyticklinghecklingbucklingducklingsucklingpricklingtricklingswashbucklingcrackingblacklistblack listnecklinecrackcrackercrackedcrackdowngimcrackcrackpotwisecrackcrack a jokecrack of doomfirecrackerinklingweaklingdarklingtinklingsparkling
Total 63, 30 Per page  3/3  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words