Sentencedict.com
 Directly to word page Vague search(google)
Home > Sac in a sentence

Sac in a sentence

  up(0)  down(2)
Sentence count:206Posted:2017-05-29Updated:2020-07-24
Similar words: sacksacredsackedalsaceransackyolk saccul-de-sacget the sackMeaning: [sæk]  n. 1. an enclosed space 2. a case or sheath especially a pollen sac or moss capsule 3. a member of the Algonquian people formerly living in Wisconsin in the Fox River valley and on the shores of Green Bay 4. a structure resembling a bag in an animal. 
Random good picture Not show
61. Staphylococcus epidermidis and Corynebacterium were the dominant strains in conjunctival sac of middle age and elder Yi people.
62. Extrapancreatic fluid collection was most commonly seen in the anterior pararenal space(30 cases, 51.7%), followed by the lesser sac(26 cases, 44.8%).
63. Objective To observe the clinic effect of hydroxyapatite ( HA ) implantation combined with conjunctival sac plasty.
64. Pollen tube entered the embryo sac via one synergid and in it released two sperms.
65. ObjectiveTo investigate the clinical efficacy of retrosigmoid vestibular neurotomy and Endolymphatic sac surgery for treatment of Meniere's disease.
66. The digestive system consists of esophagus, stomach, style sac, intestine, rectum and digestive gland, etc.
67. Key words: lumbar spinal morphology, spinal stenosis, positional MRI, axial load, dural sac cross - sectional area.
68. POD and SOD isoenzyme were closely related to the juicy sac granulation.
69. Results Mouse embryos were successfully hatched, adhered, implanted and outspreaded under the coculture system. The extraplacental cone and amniotic sac were formed as well.
70. Synergid cells Two haploid cells located near the egg cell at the micropylar end of the embryo sac in flowering plants.
71. Note the undercutting of the lamina with bilateral decompression of the thecal sac.
72. Using Mayo scissors , the posterior cul - de - sac is entered sharply, and the peritoneum identified.
73. Otic vesicle An epithelial sac behind the fifth rhombomere forming the semicircular canals dorsally and the otolith organs ventrally .
74. Painting proved to be a cul - de - sac for Philip Carey, as he had no real talent.
75. Objective To investigate the clinical value of dilater curing contract of conjunctival sac.
76. One touch of a female's egg sac and they go ballistic, grappling any other male within reach.
77. He now is removing the pericardial sac and free up the liver for removal.
78. Modern western ethics has long been trapped in a cul de sac of deep crisis.
79. At the early globular embryo, the chalazal portion of the embryo sac grown into tubular haustorium, which still remained coenocytic.
80. AQP 2 located in stria vascularis , Corti's organ [sentencedict.com], spiral ganglion and endolymphatic sac.
81. This paper gives the designing requirement of an air spring rubber sac vibration isolator on the basis of analysing the vibration disturbing frequency spectrum.
82. This species is characterized by having flowers saffron, lip "T"-shaped, lobules of epichile squarish and not much longer than wide, and each side of sac with only one callus inside.
83. The air sac can also be internally filled with a certain amount of gas generant which includes carbonate and pharmaceutically acceptable organic acid.
84. Objective To study the relationship of blood flow (ESBF) and the posterior meningeal artery (PMA) and posterior vestibular artery (PVA) in endolymphatic sac of guinea pigs.
85. Antibody to AFP has been shown to be useful in detecting hepatocellular carcinomas (HCC) and germ cell neoplasms, especially yolk sac tumors.
86. To evaluate the effect of excision of the fistulous tract in the treatment of congenital lacrimal sac fistula.
87. Then the uninucleate embryo sac forms 7-celled or 8-nucleate embryo sac of polygonum type following its three times division successively.
88. Adopting Simple Adaptive Control (SAC) theory among other modern control theories,[http://sentencedict.com/sac.html] realized robust adaptive control absorbing automatically plant parameter changes and plant time-variant influences.
89. So it defined as crassinucellate. The megaspore mother cell divides transversally to form a linear megaspore tetrad. The megaspore at the chalazal end develops into the embryo sac mother cell.
90. In apes the hyoid attaches to a large pouch called an air sac, that makes sounds bigger and deeper.
More similar words: sacksacredsackedalsaceransackyolk saccul-de-sacget the sackrucksacksacristymassacreknapsacksacrilegesacrificehit the sacksacramenthaversacksacrosanctpass acrosssaccharineransackingmass actionsacramentaltransactionsacrificialsacrilegiousas a consequencesavings accountas cool as a cucumber
Total 206, 30 Per page  3/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words