Sentencedict.com
 Directly to word page Vague search(google)
Home > Ish in a sentence

Ish in a sentence

  up(0)  down(0)
Sentence count:14+1 Only show simple sentencesPosted:2017-04-23Updated:2020-07-24
Similar words: whishfishwishdishswishdishesIrishfishery
Random good picture Not show
1. He stayed at the ISH, from whose lofty heights he could see across New York.
2. I've finished preparing the food. Ish. I just need to make the sauce.
3. Especially those who wrote in complaining about ish 82 and the new look.
4. Even if the current so-called civil society,[sentencedict.com] thew ish of equals between man and woman is hard to achieve. The life will be vapidness if it can be achieved.
5. Objective To investigate the feasibility of applying immunohistochemistry (IH) and in situ hybridization (ISH) technique to the undecalcified bone sections.
6. Methods In situ hybridization (ISH) of frozen sections of 15 human breast cancer using digoxigenin labeled estrogen receptor (ER) cDNA probe to identify the expression of ER mRNA have been done.
7. A N ew R ad ish C u ltivar'Q iufeng 2'
8. MR COEBEN , 50 ish , short pudgy, climbs carefully back through the window.
9. P 16 messenger RNA ( mRNA ) , p 27 mRNA weredetected by in situ hybridization ( ISH ) in these tissues.
10. Goyle has short, bristly hair and long, gorilla - ish arms.
11. Crabbe has a flat noe, pudding - bowl haircut, and gorilla - ish arms.
12. They will be even more effective if the dilettante - ish applies himself.
13. Sa: it was a very French deja vu - ish kind of thing . Oui ( French for yes ).
14. Conclusions The undecalcified bone sections of human made in the method can satisfy the need of IH and ISH.
More similar words: whishfishwishdishswishdishesIrishfisheryperishbanishcherishmishapsquishdish outfamishnourishlavishrelishfetishimpishgeisharavishrakishradishgarishvanishparishwish forbishopJewish
Total 14, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words