Sentencedict.com
 Directly to word page Vague search(google)
Home > Strings in a sentence

Strings in a sentence

  up(3)  down(2)
Sentence count:260+12Posted:2017-05-17Updated:2020-07-24
Similar words: pull the stringsstringhamstringstringentastringentshoestringstringencyastringencyMeaning: [strɪŋ]  n. the section of an orchestra that plays stringed instruments. 
Random good picture Not show
121. Not only in agriculture, but in industry generally, grant money should have strings attached.
122. Now the smell has become rosy, it evokes strings of memory that weave into something new.
123. Given some output from the pattern recogniser, all possible candidate strings should be generated.
124. The woodwind maintained a perfect pitch and, like the strings and brass, produced a consistently voluptuous sound.
125. Racket strings are divided into two groups - natural gut and synthetics.
126. The bridge is interesting, too, with six fully adjustable knife-edge saddles, one for each pair of strings.
127. A boyfriend offered me a weekend in Amman, with no strings attached.
128. The strings unfold a sequence of shivery chords, and voice and oboe briefly entwine before the singer is left in solitude.
129. How he must have wished to have been in the puppet's place, no policies, work and no strings attached.
130. Elfed could and did pull strings on the local Co-operative committee.
131. When boar is finished cooking, remove strings and set on platter. Cover with aluminum foil to keep warm.
132. Instead[Sentence dictionary], Tania Maria's voice floats sexily around swelling strings and simple acoustic guitar.
133. The strings in the recogniser output column are the calculated top ranked candidate string for each word.
134. To put it bluntly, nobody cares about strings of nucleic acids at all!
135. Strings of spittle hanging from pointed teeth to lower lip reflected moonshine as the cadaverous head arched skywards.
136. We don't know how to change the strings and my son hasn't got a clue who Hank Marvin is!
137. There are four pianos in the pit, two with sheets of paper laid across the strings to produce dull percussive sounds.
138. Nevertheless, the purse strings have been loosened sufficiently to provide a palatable enough feast.
139. In their accompaniments, the strings could have contributed greater warmth and colour - particularly by using more vibrato.
140. V.. How to create and modify setup strings varies among operating systems and specific software.
141. Of most concern is getting the best sound out of the instrument without the strings pulling it apart and needing returning too often.
142. They did acquit themselves well with heavier strings and a flat pick[sentencedict.com], but in the main they were seen as fingerpicking guitars.
143. Using n-grams, those candidate strings which are found to exist in the list of n-grams are then stored in a list.
144. A field system could be defined as strings of coordinates following each field boundary, along with reference names or numbers.
145. Strings of paraffin lamps gleam along the upper decks and dance in the inky water.
146. Local officials sometimes complained about adverse decisions and strings attached to the grant but generally seemed satisfied.
147. Janir leaned against her back, toyed with her hair, crawled into her lap and played with the nearest harp strings.
148. Whatever else you do, please avoid musicianly prattle about your favourite brand of guitar strings.
149. Note that only crotchet rhythm is given to the strings.
150. I had never heard cellos and low strings added to rock songs.
More similar words: pull the stringsstringhamstringstringentastringentshoestringstringencyastringencymooringsbearingsringsidehot springsfiring squadscoring systemstrivingstrikingtriggeringstrip miningrestructuringpedestrian crossingangstromwingsdoingsstripupbringingring fingersavingsspringinglingeringstrike
Total 260, 30 Per page  5/9  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words