Sentencedict.com
 Directly to word page Vague search(google)
Home > Iff in a sentence

Iff in a sentence

  up(0)  down(0)
Sentence count:17Posted:2018-06-03Updated:2020-07-24
Similar words: riffjiffbiffiffymifftiffcliffsheriff
Random good picture Not show
1, Solution: IFF inoperative in OFF mode.
2, The TSB 2500 IFF Combined Interrogator Transponder is one of the most advanced systems compliant with the latest NATO and International Civil Aviation Organization (ICAO) standards and regulations.
3, The radar includes a fully integrated Identification Friend or Foe (IFF) interrogator system.
4, A complete lattice L is called a C-lattice iff it is distributive and has a base consisting of irreducible elements.
5, IFF is one of important application of automatical target recognizing ( ATR ) technology.
6, Kurt watched his motion tracker, IFF tags overlaid on the grid.
7, Identification Friend - or - Foe ( IFF ) system is very important in modern warfare.
8, This predicate returns true iff u has extended a friendship invitation to v.
9, A complete lattice L is called a C-lattice iff it is distributive and has a base consisting of irreducible elements. Some properties of C-lattices have been discussed in this paper.
10, IFF ( Identification between Friend or Foe ) system is very important in modern wars.
11, For example, the MSSR 2000 I interrogator is operated by the naval forces of Germany, France,(http://sentencedict.com/iff.html) Norway and Finland for the military friend-or-foe identification (IFF).
12, Thales demonstrated its Reverse Identification Friend-or-Foe (IFF) concept at Eurosatory on 18 June: a system designed to eliminate friendly fire during air-to-ground engagements.
13, A total function fis a Context—free Infinite Preserving Function if and only iff is a Context—free Preserving function.
14, As an application, it is proved that a continuous map of an interval is chaotic iff it is distributively chaotic in a sequence.
15, The main result is as follows: Let X be a regular space, then the nonempty closed subsets hyperspace is locally compact iff X can be represented as the sum of a compact space and a discrete space.
16, The radar provides the helicopter with long-range search, imaging and tracking of surface vessels, a periscope detection mode, and the IFF to identify other aircraft in flight.
17, An enemy attacker?He presses a key on his radar console, and his IFF interrogation equipment sends out a coded signal.
More similar words: riffjiffbiffiffymifftiffcliffsheriffwhiffskiffspiffsniffjiffyquiffstiffdiffuseeiffeldifferspiffyspliffsniffyriffletariffmiffedpiffletiffintiffanygriffonpontiffgriffin
Total 17, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words