Sentencedict.com
 Directly to word page Vague search(google)
Home > Helix in a sentence

Helix in a sentence

  up(0)  down(1)
Sentence count:139Posted:2017-04-05Updated:2020-07-24
Similar words: elixirheliumon the lineto the lifeand the liketoe the lineto the limitdraw the lineMeaning: ['hɪːlɪks]  n. 1. a curve that lies on the surface of a cylinder or cone and cuts the element at a constant angle 2. a structure consisting of something wound in a continuous series of loops 3. type genus of the family Helicidae. 
Random good picture Not show
31. DNA double helix in solution become more loose in the presence of non - planar structure 1,4 - DHP derivatives.
32. Then, it is indicated that the gearing used presently, while its helix angle and ratio are both big enough, is in danger of interference.
33. Glycine, Citric Acid, Allantoin, Hedera Helix, Dexpanthenol, Aloe Barbadensis, Witch Hazel, Sodium chloride, Butylene Glycol, Sodium Citrate, Perfume, Pure Water.
34. If helix angle is equal to or slightly smaller than the angle which makes two meshing boundary lines coincide with each other, preferable meshing performance is obtained.
35. Helical gear with different helix angles is a particular gear is widely used in polishing grinder.
36. The optivity of annulene compounds abided by the helix law, that is, right handed helix is D-rotatory and left handed helix i...
37. Based on the triple helix theory, starting from the concept of Triple Helix Interface Organization (THIO), structural forms of bilateral THIO and trilateral THIO are presented.
38. Programming by the plane curve unwrapped from the helix curve and cutting layer by layer, we created the variable pitch screw on the 3.5 axis NC milling.
39. This paper analyzes the regularity of coil shift angle and helix angle variation and their effects on bobbin forming.
40. This paper focuses on the optimal pitch arrangement in double-side heating once-through steam generator with helix tube inside.
41. Using high viscosity fluid of Xanthan gum solution as experimental material, heat transfer enhancement experiments were respectively made in smooth tube, helix tube, GK tube and SMK tube.
42. What kind of motives are more likely to lead to good science: Competitive motives, like the motive JD Watson described in The Double Helix , to get the structure of DNA before Linus Pauling did?
43. Application and technology essentials of vacuum evaporation film used in high power helix TWT are summarized.
44. Then, we analyze the field-distribution in the High-frequency structure with helix cavity and gain the distribution function in the interaction space.
45. Normal, double - helix DNA is spiral, like a loosely coiled spring.
46. It adopts large helix angle and special arc configuration that is suitable for processing some hard materials such as stainless steel and titanium etc.
47. It provided strong evidence of the structure of D - N - A as a double helix.
48. Purpose To recognize the value of double helix CT in diagnosis of Chronic otitis mastoidea.
49. The alpha helix is found in muscle protein and keratin.
50. YK2045 NC cylindroconical helix gear grinding machine is the first NC cylindroconical helix gear grinding machine of 5 axes linkage with 7 axes in our country.
51. This model can increase the calculated value of the attenuation constant. The results indicate that the loss of the helix occupies most of the whole loss.
52. The column helix compress springs contains the ending ring and rubdown structure.
53. And helix rises type balata firmly sealed faucet kind the three-piece suit price of the product is 400 yuan about - 500 yuan.
53. Sentencedict.com is a online sentence dictionary, on which you can find excellent sentences for a large number of words.
54. It is a multiply Aluminium Polyester Laminated ducting with an en - capsulated high tensile steel wire helix.
55. And helix rises type balata firmly sealed faucet kind product three-piece suit makes an appointment with 400 yuan - 500 yuan.
56. The vertical height of transmission for each set of flectional helix conveyer will be as high as 10m and the horizontal distance will be 25m.
57. The helix conveyer can transmit material in straight line and also flectional transmission. Because it has high flexibility, it makes operator can arrange all kinds of equipment conveniently.
58. This paper simplifies the gear change calculation and machine adjustment in machining equiangular helix conical milling cutter with non-circular gear method.
59. Double Helix crowded XSJ - pulp, paper pulp for the extraction of black liquor.
60. Can be alga of honey, calcium tablet, helix taken together?
More similar words: elixirheliumon the lineto the lifeand the liketoe the lineto the limitdraw the linehelicopterheliocentricread between the linesflixprolixityhelpshellhelmhellshelfheldhelenwhelmbushelhelloshelterhelp outhelmethelpingnutshellcannot helpsatchel
Total 139, 30 Per page  2/5  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words