Sentencedict.com
 Directly to word page Vague search(google)
Home > Unhealthy in a sentence

Unhealthy in a sentence

  up(1)  down(4)
Sentence count:178+6Posted:2017-02-25Updated:2020-07-24
Synonym: ailingfeeblefrailillindisposedinfirmrun-downsicklyunsoundunwellunwholesomeweakSimilar words: healthywealthystealthyhealthhealthcarewealthstealthilycommonwealthMeaning: adj. 1. not in or exhibiting good health in body or mind 2. detrimental to health 3. not conducive to good health. 
Random good picture Not show
61. Competition is healthy. Especially when all your competitors are unhealthy, and hopefully sick and absent during the competition. Jarod Kintz 
62. He has such an unhealthy lifestyle -- smoking, drinking, eating too much.
63. And they are given interpersonal strategies to avoid peer pressure to make these unhealthy choices.
64. The environment for Windows add-on vendors is becoming distinctly unhealthy he says, as Microsoft adds functions into the base operating system.
64. Sentencedict.com try its best to collect and build good sentences.
65. You know, Nicholas, that whatever miseries the Great War brought it destroyed a great deal that was unhealthy between the sexes.
66. But unfortunately, they can also give rise to unhealthy fears.
67. Extreme positions, however, whether of the right or left brain, are unbalanced, out of harmony and therefore potentially unhealthy.
68. Healthy fears block the path to failure, while unhealthy fears steer organizations away from growth and success.
69. In our Western diet we eat more than twice as much protein as we need, and of an unhealthy type.
70. Unhealthy Environment A stable environment can, unfortunately, be an unhealthy one.
71. The best thing to do is keeping the positive and healthy desires awake, and keeping the negative and unhealthy desires asleep. Dr T.P.Chia 
72. He had a bony wizened face and an unhealthy pallor.
73. Some managers come away from virtual reality demonstrations with unhealthy visions of holograms dancing in their heads.
74. Campaigners say his case reveals the unhealthy power that big busi ness holds over the federal law makers.
75. My mother thought it was unhealthy to sleep with the windows shut at night.
76. It need not surprise anybody that Victorian cities were unhealthy places.
77. Cigarette smoke is just one unhealthy air pollutant which is removed by Rentokil electrostatic air filters.
78. And yet many of you are probably making yourselves unhappy and unhealthy by squeezing yourselves into career decisions made long ago.
79. His love for Eloise had been unhealthy, red-hot, bound to burn itself out sooner or later.
80. I leap up, another unhealthy rifle crack emitting from the same knee.
81. Soon after the departure of Roszak from Peace News McGrath had quit that paper, nursing an unhealthy obsession with drugs.
82. Competition characterises a healthy organisation and conflict an unhealthy organisation.
83. One of them was a doctor, a large, unhealthy looking specimen with a huge warty nose covered in broken veins.
84. What may be unhealthy is the desire for instant transformations, the desire for that change to take place in an instant.
85. Banished from the official organizational history, the memory of these unpleasant side effects lingers in the form of unhealthy core beliefs.
86. As long as animals eat unhealthy plants, the vets will have to do likewise.
87. The Government and its chief medical officer disagreed over whether sugar is unhealthy.
88. Lots of smart people are interested in the problems of unhealthy and unproductive workplaces and what to do about them.
89. It is unhealthy to dramatise life.
90. This ingrate attitude and the unhealthy consumption negatively impact.
More similar words: healthywealthystealthyhealthhealthcarewealthstealthilycommonwealthfilthypinheadmaidenheadalthoughdealtfealtyhealappeal tounhappyinheritinherentinheritorinherentlypithyworthyearthyapathylengthyempathywith youngallopathysympathy
Total 178, 30 Per page  3/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words