Sentencedict.com
 Directly to word page Vague search(google)
Home > Sampler in a sentence

Sampler in a sentence

  up(0)  down(0)
Sentence count:51Posted:2017-12-13Updated:2020-07-24
Synonym: sampling stationtaste testertaste-testertasterSimilar words: samplesample sizerandom samplequota samplesample surveystratified samplerepresentative samplesamplingMeaning: ['sæmplə(r) /'sɑːm-]  n. 1. an observation station that is set up to make sample observations of something 2. someone who samples food or drink for its quality 3. an assortment of various samples 4. a piece of embroidery demonstrating skill with various stitches. 
Random good picture Not show
1, a sampler of American short-story writers.
2, The chef made up a dessert sampler platter for us.
3, You can elaborate on this sampler idea by putting the words inside another design.
4, A sampler commemorating the birth of a new baby also makes a marvellous present for the proud parents, or even grandparents.
5, Tip: Have the chef make up a dessert sampler platter.
6, Installed an Apple Mac sampler at every desk and things have never been the same since.
7, Soil is sampled with a core sampler.
8, Their dorm is a Sampler of women.
9, Sampler: The sample chamber is defined by sustomer.
10, Textures describes how to set up a texture sampler.
11, Introduce the sampler in the liquid until sampling depth.
12, The simplest type of rain sampler is essentially a funnel and bottle.
13, PICKER CLAR - PC - 31625 Sampler solids specially designed to sample products in bulk bags, bags or open drums.
14, By using a digital sampler or a sequence program, everyone can easily build his own sounds in an innovative way.
15, The present invention provides a sampler for investigating the homoptera insect.
16, Complimentary sampler of our new cream with any $ 25 purchase.
17, The upper surface of the sampler body is provided with a plurality of water outlets.
18, The utility model discloses a carton tobacco strip sampler, comprising a base (2) and a tubular sampling pipe (1), wherein the end of sampling pipe is movably connected with the base (2).
19, This sampler can be used only in streams shallow enough to be waded.
20, Knock the sampler off,[http://sentencedict.com/sampler.html] and let the sample drop out by itself.
21, Don't feel virtuous: charity is only a by-product of this very good sampler of contemporary literature.
22, The remaining buttons access the MIDI side of the Alpha, along with the sampler, utility and recall functions.
23, At the show, a souvenir booklet was given away, as well as free sampler 455 featuring album cuts.
24, It is an ideal equipment to replace the old sampler.
25, It can be concluded from the result that the real waveform of the three-phase current and voltage can be reverted to the host by the data sampled by the sampler.
26, This dynamic capability is not possible with using only a gravimetric particulate sampler.
27, A device made of plexiglass is added gas absorption tubegas flowmeter in the atmospheric sampler.
28, All 1300 plus loops are duplicated into Apple Loops and REX files as well for maximum flexibility with nearly any music sampler, DAW, or loop software.
29, To improve the sensitivity of the exiting accelerometer , an exclusive charge amplifier is integrated with a data sampler and analysis software , forming a portable micro2vibration test system.
30, Objective To identify Paeonia lactiflora Pall. and its confusable varieties by Fourier transform infrared(FTIR) spectroscopy assisted with OMNI sampler.
More similar words: samplesample sizerandom samplequota samplesample surveystratified samplerepresentative samplesamplingamplesampling errorrandom samplingexampletrampletrampledexamplessimplerfor exampletrample onunexampledgood examplecounterexamplerepresentative samplingchorionic villus samplingsampsampanamplyamplifyswamplandtemplecomplete
Total 51, 30 Per page  1/2  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words