Sentencedict.com
 Directly to word page Vague search(google)
Home > Knitted in a sentence

Knitted in a sentence

  up(0)  down(3)
Sentence count:203+2Posted:2017-07-17Updated:2020-07-24
Similar words: knittingpittedwittedfittedcommittedadmittedacquitteduncommittedMeaning: ['nɪtɪd]  adj. made by intertwining threads in a series of connected loops rather than by weaving. 
Random good picture Not show
91. He was wearing a brown knitted jumper and khaki trousers.
92. The finished effect is a knitted tube, the basis is a slip stitch technique.
93. The animal is knitted as a single motif just as it appears on the graph.
94. One deaf centre contributed over 700 knitted pairs of woollen socks.
95. Suppose you have 130 stitches cast on and you have knitted to where you want to start the neckline.
96. The final sample began as a row of green trees in red tubs, knitted double the height and width.
97. My mother knitted me a pullover.
98. One of her sisterhood knitted beside her.
99. She knitted an astounding purple scarf.
100. A knitted , unbleached cotton fabric for underwear.
101. This stylish sweater was knitted by a young knitter.
102. This Knitted Slipcover is something really unique and creative.
103. Knitted waistcoat with tuck detail at shoulder. 48 % Acrylic, 48 % Merino Wool, 4 % Other.
104. Full-fashioned stockings were knitted flat, then shaped and seamed up the Back by hand.
104. Sentencedict.com is a sentence dictionary, on which you can find nice sentences for a large number of words.
105. Color difference are easily appeared in cotton knitted fabric reactive dyeing in deep shade.
106. Monty was wearing a dark blue knitted sweater and over it an open leather windbreaker.
107. Several factors affecting the spirality of aramid knitted fabrics made by the flat knitting machine were discussed.
108. In the example of tights, elastane defects in knitted fabrics are defined.
109. The invention also provides a solvent for the production process of knitted impregnated PU gloves, which is prepared from polyurethane resin and methyl l pyrrolidone according to a certain proportion.
110. By surrounding a gas-tight, pattented V-Seal with two compressed knitted wire mesh air gap spacers, the connection is made by simply sliding one section of pipe over another.
111. Readymade Garments, Knitwear and Knitted Fabrics, Women Wear, Ladieswear, Knitwear, Garments.
112. I gave her a knitted shawl as a Christmas gift.
113. Athletic Wear, Leather Garment, Knitwear and Knitted Fabrics, Knits, Leather Apparels, Sportswear, Westernwear.
114. To Ron from Mrs. Weasley: a maroon hand - knitted sweater, always in maroon.
115. Bravor bleacher is specialized in bleaching intractable dirt, odor, tea dirt, coffee, blood stain and flavorings, etc that make white cloths and knitted material becoming whiter and cleaner.
116. Based on practical application[sentencedict.com], it is found that continuous rope bleaching machine exerts serious influence on the shrinkage and other quality problems of the knitted goods.
117. Mainly products are: velvet and interlock baby romper, velvet children wears and adult knitted leisure garments.
118. She purchased a knitted petticoat and sent it to the Thenardiers.
119. Methods Domestic Ni-Ti alloy was knitted tubular mesh stents, wrapped with domestic silk- dacron woven graft. The stent-graft was inserted into introducer sheath.
120. It is one of the main equipment for developing weft - knitted velvet stuff.
More similar words: knittingpittedwittedfittedcommittedadmittedacquitteduncommittedhalf-wittedadmittedlysharp-wittedtransmittedknitsexually transmitted diseaseclose-knitnitty-grittypitter-patterbittenjitterlittermittenbittertitterkittenfitterfritterwrittenemitterjitteryglitter
Total 203, 30 Per page  4/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words