Sentencedict.com
 Directly to word page Vague search(google)
Home > Knitted in a sentence

Knitted in a sentence

  up(0)  down(3)
Sentence count:203+2Posted:2017-07-17Updated:2020-07-24
Similar words: knittingpittedwittedfittedcommittedadmittedacquitteduncommittedMeaning: ['nɪtɪd]  adj. made by intertwining threads in a series of connected loops rather than by weaving. 
Random good picture Not show
121. Intercostal is made from web and flanges and is tailored from a whole knitted - stitched laminate plate.
122. The girl was wearing a dark green knitted sweater and a windbreaker over it.
123. Fur hat, fur bag, fur garment, fur material, fur coat, fur knitted, knitwear, fur scarf and shawl, feather, feather product.
124. Selection and association of material plays a very important role in developing knitted fabric.
125. In hygrometric condition, there are only fuzzs appearing on milk protein knitted fabric.
126. Women Wear, Garments, Knitwear and Knitted Fabrics, Ladieswear, Knitwear, Garments.
127. He clinched his hands. He knitted his brows and tightened his lips.
128. She gave me this jumper, which she had knitted herself.
129. Adopting high - strength and high - modulus alkali - free glass fiber, it is knitted into loom.
130. First commercialization application just is knitted make sock and parachute.
131. We can supply various wool - knitted goods , cotton piece goods , corduroy, etc.
132. When I first saw this picture I was really impressed by the beauty of this knitted slipcover, and by the time involved into this project.
133. Island composite wire continues to maintain a fixed PIN, mainly downstream warp knitted suede fabric sell well.
134. We totally have two fully owned factories in China. One is located in Guangzhou, which mainly produces knitted and tatted wear. Another is in Dongguan, which specializes in sweater.
134. Sentencedict.com try its best to gather and create good sentences.
135. Madame Defarge knitted steadily, but the intelligence had a palpable effect upon her husband.
136. Used for testing the bursting strength and bursting distension of knitted or woven fabrics, non-woven fabric and other fabrics, It is controlled by the PC, the testing result is printed by printer.
137. A close - fitting knitted pullover shirt, jacket , or sweater.
138. Changshu Jiaying Textile is a corporation who produce knitted fabrics. Jiaying Textile repose on Changshu southeast Economic Development Zone of Jiangsu. Jiaying Textile was establish in 1998.
139. Shirts, Skirts, Dresses, Trousers, Jackets, Knitwear, Pullovers , Rainwear, Junior Fashion, Street Wear, Trousers Knitwear and Knitted Fabrics.
140. This paper presents dyeing and finishing process of mercerized knitted fabric cotton based on production practice.
141. A guernsey is a warm, knitted wool shirt first worn by seaman in this area.
142. Madame Defarge knitted with nimble fingers and steady eyebrows, and saw nothing.
143. Main material of knitted part: spun silk , silk cotton and kapok , acrylic and cotton , cotton , rulex, rayon etc, and mostly are 12 gauge.
144. Using disperse turquoise blue BGN for dyeing polyester knitted fabric often causes color stain.
145. Knitwear and Knitted Fabrics, Readymade Garments, Women Wear, Ladieswear, Knitwear(sentencedict.com), Garments.
146. I engaged in more than a decade, to knitted garments. Jean. Foreign trade cotton-padded clothes. Dust coat jackets. Women's leather coat is more experienced.
147. Except the jeans, we have denim dress, knitted top, T shirt etcs.
148. Knitwear and Knitted Fabrics, Athletic Wear, Golf Apparel, Knits, Sportswear.
149. The new coated fabric used for membrane is made by multi axial warp - knitted fabric.
150. This article basing on the cellulase finining , anti-crease and anti-bacterial finishing and relative theory of cotton woven fabric finds an explorative finishing way of pure cotton knitted fabric.
More similar words: knittingpittedwittedfittedcommittedadmittedacquitteduncommittedhalf-wittedadmittedlysharp-wittedtransmittedknitsexually transmitted diseaseclose-knitnitty-grittypitter-patterbittenjitterlittermittenbittertitterkittenfitterfritterwrittenemitterjitteryglitter
Total 203, 30 Per page  5/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words