Sentencedict.com
 Directly to word page Vague search(google)
Home > Hybridity in a sentence

Hybridity in a sentence

  up(0)  down(0)
Sentence count:20Posted:2018-08-02Updated:2020-07-24
Similar words: hybridizehybridizationhybridisationhybridaridityacidityavidityvalidity
Random good picture Not show
1. Because of the"hybridity"characteristic of the South Korean culture.
2. To be sure, hybridity poses risks.
3. The phenomenon of hybridity exists in many fields of natural sciences and social sciences.
4. Therefore,[Sentencedict.com] it is quite proper to introduce the concept of "hybridity" into the study of literary translations.
5. Hybridity, signifying and double-voice may be the novel's most outstanding diasporic features in artistry.
6. It is by this hybridity that teachers are able to reclaim the wholeness of their lives.
7. A culture should frankly face the hybridity in exchange with others.
8. Hybridity , for the marginalized people, is a way of cultural resistance to colonialism and the Western cultural domain.
9. Hence, the issue of hybridity is felicitous rationale for the elaboration of Kureishi's works.
10. Bhabha's theory of hybridity together with other post-colonial literary theories to read and explain the complicated situation of both Indian culture and white culture.
11. Moreover, research on hybridity in postcolonial translation studies in a certain sense also support the prototypical view of translation.
12. In the chaotic hybridity into the busy, no time to organize travel the feelings of those beautiful people tempting frustration with the piece was put aside.
13. In the process of translation, there are always the cases of cultural hybridity .
14. Researchers have propounded the main target of rice apomixis . It is dominant and simplicity, specificity and spontaneity, facultative and lethal, polyploidy and hybridity.
15. Chapter Two and Chapter Three are devoted to Rushdie's cultural and stylistic hybridity from three aspects respectively.
16. Now what happens then in Tony, to move to a slightly different way of thinking about it, is we can see that it's a global story masked as a story of hybridity in the American melting pot.
17. Chapter five presents Willie's reconstruction of his identity based on Said's concept of cultural resistance and Bhabha's theory of hybridity .
18. The analysis explicates the relationship of the internal structure of an argument and the hybridity of discourse, which might be of interests to the discourse analysts.
19. It is the pragmatism and its philosophical and aesthetic by-products that have oriented contemporary Chinese art and culture toward a direction of hybridity .
20. Thus, it is necessary to study the process of acculturation with regard to translation and tackles related questions of identity, hybridity and metamorphosis.
More similar words: hybridizehybridizationhybridisationhybridaridityacidityavidityvalidityrapiditytimidityvapidityhumiditycupiditylucidityfluidityrigiditysoliditysapidityturbidityliquiditylimpidityrancidityfrigidityviscidityplaciditystupiditymorbidityflaccidityinsipidityinvalidity
Total 20, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words