Sentencedict.com
 Directly to word page Vague search(google)
Home > Escherichia in a sentence

Escherichia in a sentence

  up(0)  down(0)
Sentence count:90Posted:2017-08-23Updated:2020-07-24
Similar words: escherichia colibe rich inparochial schooleschewricherescheatrichesrichenMeaning: n. a genus of enteric bacteria. 
Random good picture Not show
31. Objective To investigate the impact of non target gene mutations and reduced permeability of the outer membrane on quinolone resistance and multiple antibiotic resistance(mar) in Escherichia coli .
32. The aminopeptidase from Streptomyces griseus (SGAP) has been cloned and expressed in Escherichia coli.
33. Overall, Amy card star, that Nebuchadnezzar flubendazolum brulamycin, sulfuric acid test for jinggangmeisu chicken escherichia coli sensitivity is highest.
34. Pseudomonas aeruginosa, Escherichia coli , Klebsiella pneumoniae and fungi were the main pathogens.
35. OBJECTIVE To study the mutation in DNA gyrase A of Escherichia coli resistante to quinolone antibiotics.
36. Methods Free-living amoebae were incubated on the agaric solid medium which had been covered with Escherichia coli in control group.
37. Twenty-six strains of virulent Escherichia coli were isolated during epidemiological survey of colibacillosis in ducks in Zhejiang and the characteristics of the disease were studied.
38. Objective To compare and discuss a few preparative methods of competent Escherichia coli cells.
39. Objective: To determine the oral immunogenicity of B subunit of Escherichia coli Heat-labile enterotoxin expressed in transgenic potatoes.
40. The extracellular proteases ( ECPase ) of 100 Escherichia coli strains were detected by using the skim milk plate.
41. Through testing on sequences from coding and non-coding part of Escherichia coli, this algorithm excelled other algorithm in average error rate.
42. Uncooked meat may contain organisms such as the Escherichia coli bacteria , also known as E . coli .
43. Based on tetranucleotide parameters(Sentencedict.com), a statistical mechanical model was suggested to analyze the flexibility of the Escherichia coli genome.
44. Using immunohistochemical method, distribution of enterotoxins of enterotoxigenic Escherichia coli( ETEC) in small intestine of the guinea pig infected with ETEC.
45. The three dimensional structure of homoserine transsuccinylase from Escherichia coli(EcHTS) was modeled by using homology and molecular dynamics methods.
46. Enterotoxigenic Escherichia coli(ETEC) strains remain a formidable cause of diarrheal disease.
47. The control microorganisms were added to samples including Staphylo- coccus aureus, Escherichia coil, Bacillus subtilis, Candida albicans, Aspergillus niger.
48. Escherichia coli or fecal streptococci contamination will be indicated by the presence of fecal coliforms.
49. Objective : To investigate active efflux of drugs in clinical isolated strains of Escherichia coli.
50. Methods Established mice colpitis model by intravaginal bacterial injection with Escherichia coli, and treated by 10% and 20% propolis tincture.
50. Sentencedict.com try its best to gather and build good sentences.
51. Diarrhoea of neonatal and post-weaning piglets strongly related with the fimbriae mediated adhesion and toxins producing ability of enterotoxigenic Escherichia coli (ETEC).
52. K88 fimbriae is one of the major colonization factors associated with porcine neonatal and post-weaning diarrhea caused by enterotoxigenic Escherichia coli(ETEC).
53. The Escherichia coli strain DH42 is sensitive to high osmolarity in an alkaline medium.
54. In this paper, the steady - state optimization of tryptophan biosynthesis in Escherichia coli is discussed.
55. The experimenters tested whether they could replicate the slime gradient in other kinds of bacteria, including Bacillus subtilis, Micrococcus luteus and Escherichia coli.
56. Process control of recombinant Escherichia fed - batch culture should be optimized.
57. Objective:To construct multivalent vaccine against bacterial diarrhea, which can express coli surface antigen 6 (CS6) of enterotoxigenic Escherichia coli (ETEC) and cholera toxin B subunit (CTB).
58. The drug - contained serum and bile had the obvious bacteriostatic effect on Escherichia coli, Bacillus dysteriae etc.
59. Objective To construct the prokaryotic expression vector of the sporozoite surface antigen gene of Eimeria tenella GZ strain and expression in Escherichia coli.
60. These bacteria strains were isolated from pigs, including 19 strains of Escherichia coli, 17 strains of Pasteurellosis Bacillus and 19 strains of Salmonella.
More similar words: escherichia colibe rich inparochial schooleschewricherescheatrichesrichenreschedulefriedrich engelschimericalamerican cheeseparochialpsychiatrychiaroscurochiang kai-shekpsychiatristrichmachiavellianescharnichequicheclichelichenenrichrichlyclichedrich manRichardostrich
Total 90, 30 Per page  2/3  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words