Sentencedict.com
 Directly to word page Vague search(google)
Home > Escherichia in a sentence

Escherichia in a sentence

  up(0)  down(0)
Sentence count:90Posted:2017-08-23Updated:2020-07-24
Similar words: escherichia colibe rich inparochial schooleschewricherescheatrichesrichenMeaning: n. a genus of enteric bacteria. 
Random good picture Not show
61. T-protein from Escherichia coli consists of three domains:chorismate mutase, prephenate dehydrogenase and a regulatory domain.
62. Objective: Our aim was to clone P 1 protein structure gene of mycoplasma pneumoniae in escherichia coli.
63. The deadly outbreak of Escherichia coli (E. coli) infection in Germany raised fears and questions about food safety in well-regulated countries.
64. Pathogenic avian Escherichia coli O78 is able to produce heat-labile enterotoxin (LT) with rabbit ileumligation test (RILT).
65. NDM-1 was mostly found among Escherichia coli (36) and Klebsiella pneumoniae (111), which were highly resistant to all antibiotics except to tigecycline and colistin.
66. Objective:The study focused on the colonial distribution of Flexibacter columnaris, Escherichia coli and Vibrio anguillarum on the surface of different carriers in fishpond.
67. Escherichia coli (E. Coli) is one of the most common pathogens in the medicine and veterinary surgeon clinically, which endanger the poultry industry and humans.
68. These infections are often caused by Escherichia coli and Proteus mirabilis.
69. An indirect enzyme-linked immunosorbent assay(ELISA) was developed based on a purified recombinant F41 pili protein of enterotoxigenic Escherichia coli(ETEC).
70. Bacterials including Escherichia coli, Staphylococcus aureus, Bacillus subtilis, and fungus including Saccharomyces cerevisiae(sentencedict.com), Candida tropicalis and Streptomyces griseus were used.
71. Typical rod-shaped bacteria are Escherichia coli and Salmonella bacteria, but there are many others.
72. Escherichia coli was generally resistant to the commonly antibiotics and the drug resistant rate, especially to laevomycetin, ampicillin and cefazolin, was 100%.
73. B. Microbiology. Escherichia coli is responsible for 60 to 90 percent of cases of asymptomatic bacteriuria, cystitis, and pyelonephritis .
74. In fact, by shunning science, organic producers could be increasing consumers' risk of contracting Escherichia coli and other food-borne diseases.
75. White and colleagues, headed by MIT associate professor of chemistry Alice Ting, first engineered a fluorophore ligase derived from the natural Escherichia coli enzyme lipoic acid ligase (LplA).
76. E . coli ( in full Escherichia coli ): Species of Bacterium that inhabits the stomach and intestines.
77. Once identified, the protein was recombinated and expressed in Escherichia coli, and the antibodies were detected by immunoblotting.
78. OBJECTIVE:To Research into the external anti-bacterial activeness of distillate of the rorippa toward staphylococcus aureus ATCC25923, Escherichia coli ATCC25922, pseudomonas aeruginosa ATCC27853.
79. Objective To construct the display vector based on the CS3 pili of enterotoxigenic Escherichia coli.
80. The dnaA gene with LacZ promoter was cloned into pUC 19 using the Escherichia coli DH 5 a strain.
80. Sentencedict.com try its best to collect and make good sentences.
81. OBJECTIVE To investigate the molecular cloning of the human tissue kininogenase gene and its expression in Escherichia coli .
82. Objective To investigate if a bacterial enhancer-like element (BELE) in the upstream region of Escherichia coli gln Ap2 gene had strict promoter selectivity.
83. Crystal structure of T4-lysozyme generated from synthetic coding DNA expressed in Escherichia coli.
84. In this paper, Escherichia coli was monitored with fluorescent stains and classic methods in various temperatures.
85. Producing the hydrogen fuel uses the harmless bacteria Escherichia coli.
86. The enterotoxins produced by Enterotoxigenic Escherichia coli (ETEC) are the main diarrhea-causing pathogen, and they were divided into two groups: heat-labile toxin(LT) and heat-stable toxin(ST).
87. Objective To study the germicidal mechanism of chlorine dioxide with Escherichia coli as the experimental object.
88. Choline dehydrogenase ( CDH ) isolated from Escherichia coli, can help the expression of glycine betaine efficiently.
89. Objective: To establish the rabbit model of acute lung injury (ALI) by intratracheal instillation of Escherichia coli , and to study the pathogenesis of bacteria-induced ALI.
90. Objective To construct display vector based on the CS 3 pili of enterotoxigenic Escherichia coli.
More similar words: escherichia colibe rich inparochial schooleschewricherescheatrichesrichenreschedulefriedrich engelschimericalamerican cheeseparochialpsychiatrychiaroscurochiang kai-shekpsychiatristrichmachiavellianescharnichequicheclichelichenenrichrichlyclichedrich manRichardostrich
Total 90, 30 Per page  3/3  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words