Sentencedict.com
 Directly to word page Vague search(google)
Home > Escherichia in a sentence

Escherichia in a sentence

  up(0)  down(0)
Sentence count:90Posted:2017-08-23Updated:2020-07-24
Similar words: escherichia colibe rich inparochial schooleschewricherescheatrichesrichenMeaning: n. a genus of enteric bacteria. 
Random good picture Not show
1. Bioaccumulation aqueous solutions by genetically engineered Escherichia coli.
2. DnaA, the replication initiator in the bacterium Escherichia coli, is monomeric in solution and oligomerizes upon binding to multiple initiator sites at a replication origin(5).
3. The level of Escherichia coli should not exceed 610 per 100 mL, calculated as the geometric mean of all samples collected in a calendar year.
4. Preparation of egg yolk antibody powder against Enterotoxigenic Escherichia Coli is good for the corresponding pathogenic diarrhea on the piglets.
5. Enterotoxigenic Escherichia coli (ETEC) is one of the important pathogenic bacteria that cause diarrheal disease in human and some young stock.
6. Methods: inhibition on bacteria growth, resistance to Escherichia coli endotoxin and measurement of monocytic phagocaryosis in mice were taken.
7. Antibacterial activity of MPL against Escherichia coli , Bacillus subtilis and typhi was 39.8 % , 45.3 % and 66.2 %.
8. We studied the stability of the aerosol of escherichia coli K-12C-600, a host strain for genetic engineering, in a special rotating drum with sodium fluorescein as aerosol tracer.
9. Enterotoxigenic escherichia coil (ETEC) related with diarrhoea of early-weaned piglets.
10. Results: The most common Enterobacteriaceae were Escherichia coli, Klebsiella pneumoiae, Enterobacter cloacae, Proteus and Serratia.
11. Multiple-antibiotic resistance of Escherichia coli is caused by both multiple-antibiotic-resistance regulon and efflux pump.
12. The most commonly isolated aerobic organism was Escherichia coli in 29 (56.9%) and the most common anaerobe was a bacteroid species in 13 (25.5%) patients.
13. Test strains are as the follows: Escherichia, staphylococcus aureus, salmonella, pseudomonas aeruginosa and clostridium sporogenes.
14. Most Escherichia coli were poorly susceptible to Ampicillin, Amoxicillin, Ciprofloxcin and third-generation cephalosporins. Most Escherichia coli were susceptible to Gentamicin and Aztreonam.
15. An alternative might be interference with bacterial adhesion by pathogenic Escherichia coli, which have abnormal adherence in ulcerative colitis.
16. The results showed that Alkaloids from Thermopsis lanceolate had certain inhibition on Escherichia, Pasteurella, Streptococcus and Staphylococcus.
17. Researchers have known for more than 20 years how so-called gram-negative bacteria like Escherichia coli degrade and recycle their RNA.
18. Results: The pathogens consisted mainly of staphylococci aureus, staphylococci epidermidis, Escherichia coli , streptococci haemolyticus, staphylococci haemolyticus.
19. Objective:To synthesize bilin binding protein(BBP) gene sequence, express BBP efficiently in Escherichia coli and purify the recombinant protein.
20. Morphological structure , biological characteristic, gene cluster structure and immunogenicity of avian ? Escherichia coli? was reviewed.
20. Sentencedict.com try its best to gather and create good sentences.
21. By this strategy, We successfully constructed the Streptococcus - Escherichia colt shutter vector pZB 1 and pZB 2 containing gtf genes.
22. The same bacterium was cultiveted in 6 cases, The common organisms were Escherichia Coli and pneumonco - ccus.
23. Gram - negative becillus. fungi, gram - positive bacillus , escherichia coli , candida albicans , guam - positive coccus accounted for 56.1 % , ...
24. An indirect hemagglutination assay(IHA) was set up using sheep erythrocytes sensitized with capsid protein VP2 of infectious bursal disease virus(IBDV) which were expressed in Escherichia coli.
25. Reteplase is a part of human tissue-type plasminogen . It is expressed in Escherichia Coli cells.
26. We report the case of 19- day-old female newborn with a cephalohematoma infected by Escherichia coli, and whose cerebrospinal fluid showed pleocytosis.
27. The results showed that artichoke leaf extract has the strongest antimicrobial effects on Streptomyces griseus and Bacillus subtilis, followed by Escherichia coli and Staphylococcus aureus.
28. In this paper, the gene of general odorant binding protein 2 in the antenna of Helicoverpa assulta (Guen?)was cloned and expressed in Escherichia coli.
29. Colonization factor antigens (CFAs) are important toxic and protective antigens of enterotoxigenic Escherichia coli (ETEC). Among the known CFAs, CS3 is a major fimbriae antigen.
30. Results Among 38 strains, 32 strains were Gram-negative bacilli(84.21%), including 9 strains of escherichia coli, 8 strains of pseudomonas aeruginosa and 8 strains of bacillus canalis capsulatus.
More similar words: escherichia colibe rich inparochial schooleschewricherescheatrichesrichenreschedulefriedrich engelschimericalamerican cheeseparochialpsychiatrychiaroscurochiang kai-shekpsychiatristrichmachiavellianescharnichequicheclichelichenenrichrichlyclichedrich manRichardostrich
Total 90, 30 Per page  1/3  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words