Sentencedict.com
 Directly to word page Vague search(google)
Home > Steadily in a sentence

Steadily in a sentence

  up(8)  down(4)
Sentence count:199+20Posted:2016-07-22Updated:2020-07-24
Synonym: steadySimilar words: readilysteadyinstead ofleadingsteamsteakmake a differencestep by stepMeaning: [ˈstedɪlɪ]  adv. 1. at a steady rate or pace 2. in a steady manner. 
Random good picture Not show
(181) The crime wave that spurred them has been falling steadily in times of greater economic prosperity.
(182) The fact that the number of very young women now smoking and consuming alcohol has steadily increased gives grave cause for concern.
(183) The discontent with de Gaulle's policies, which had been building steadily since 1958, suddenly burst into the open.
(184) The distant city of Lucy's dreams was becoming steadily demystified.
(185) Protein is stored in the body and blood fats increase steadily up to the time of birth.
(186) Since his retirement from the military and his triumphant book tour,(www.Sentencedict.com) Powell has edged steadily toward an active role in politics.
(187) This is 48142 steadily climbing the bank with an up ballast train.
(188) Richard's self confidence is growing steadily.
(189) He attended university and the Libyan military academy and steadily rose in the ranksthe Libyan army.
(190) In the 1880s the debt of $24 million, incurred under carpetbag regimes, increased steadily with each subsequent administration.
(191) With continued support from Seoul Archdiocese and the CMC, the clinic has grown steadily and has treated more than 13,000 patients since 2008.
(192) The people have up-and-up requirement to the real estate along with the highly and steadily development of the economy in our country since the reform and opening policy was applied.
(193) They indicate this amplifier's antijamming ability is very high, the gain multistage changes steadily, its temperature voltage drift is low, and the pulse linearity is good and so on.
(194) We hope that all teachers will work hard to steadily raise their political and professional levels and become increasingly socialist-minded and professionally competent.
(195) The system can steadily achieve the relative phase difference dynamic control of the femtosecond laser pulse pair almost without limitation of range.
(196) The raw material is introduced at the higher end and moves steadily down the kiln to the burning zone.
(197) The estate has been going steadily to rack and ruin for years.
(198) Equatorial Guinea, whose economy developed rapidly and steadily in recent years, is the member of Economic Community of Central African States and Central African Customs and Economic Union.
(199) Based on its special excellent performance and advantage, vibratory piling machine has steadily become the focal point to be studied and developed in the world .
More similar words: readilysteadyinstead ofleadingsteamsteakmake a differencestep by stepdilemmadiligentlyfamilyheavilyhappilyjauntilyprimarilyadieuteamteartradingstadiumradicalCanadianteachtear offteachertear upat easetraditionradiationtear down
Total 199, 30 Per page  7/7  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words