Sentencedict.com
 Directly to word page Vague search(google)
Home > Weakly in a sentence

Weakly in a sentence

  up(4)  down(1)
Sentence count:142+4Posted:2017-05-25Updated:2020-07-24
Similar words: bleaklyweaklingweakweakenweaknessfrankly speakingweeklysicklyMeaning: ['wɪːklɪ]  adj. lacking physical strength or vitality. adv. in a weak or feeble manner or to a minor degree. 
Random good picture Not show
61. With advanced barretter technology, modern fluorescent lamp frame possesses various advantages such as low wastage, low noise pollution, weakly frequency, high optical efficiency, and long life etc.
62. It is very important to investigate the decomposition of weakly invertible finite automata, since it could provide an approach to cryptanalyzing finite automata public-key cryptosystem(FAPKC).
63. Those who are weakly or who complain of ill health , oft outlive the more robust.
64. The acrylic fibre with weakly acidic group has a low saturation value.
65. Defining the periodic task model for weakly hard system, the PV-RM scheduling algorithm is presented on the basis of RM scheduling policy.
66. The definitions of weakly regular SPN decomposition and weak regularity condition number are proposed.
67. Our simulation results demonstrate that the max phase difference caused by particle on VCO is weakly when NMOS works in cut-off region.
68. In this paper, We establish the local well - posedness of a weakly dissipative nonlinear shallow water ware equation,[www.Sentencedict.com] and obtain the global solution and blow-up phenomena for different initial values.
69. George said weakly, " Maybe Carlson lost his gun. ".
70. A particle theory called "supersymmetry" predicts the existence of weakly interacting massive particles (WIMPs), which could be the particles of dark matter.
71. Exercises forbearance, Is equal to not necessarily weakly, The right and wrong gratitude and grudges as soon as smile with the wind may dissipate, Draws back a step of boundlessness.
72. The solitary wave theory of the weakly nonlinear, non-axisymmetric disturbances is used to model the spiral vortex breakdown.
73. The paper introduce a weakly compressible flow model for small Machnumber. Both corresponding numerical solutions of the method and the applications are given.
74. The bird struggled weakly and made a wild, strange noise.
75. When her associates addressed her in the wings she only smiled weakly.
76. Experiments show that the velocity of sonic waves is sensitive to pore fluid in sediments of weakly cemented or low effective pressure.
77. Strength draining from her body, she weakly sat upon the ground.
78. EGFR was especially stong stained where cell actively proliferated and stained weakly during late stage of tooth morphogenesis and differentiation.
79. Used to treat leprosy . It can slow down the growth and weakly kill Mycobacterium leprae[sentencedict.com], the bacteria that cause leprosy .
80. Many asteroids are weakly bound piles of rubble, held together by their own minute gravitational attraction.
81. It can slow down the growth and weakly kill Mycobacterium leprae, the bacteria that cause leprosy.
82. In this paper, we retains the cone P normal cone, increasing operator A weaken the weakly continuous operator, space E weaken the weak complete space.
83. Figure 5 . Shear and bulk modulus relation for sandstone and weakly cemented sands.
84. Seed yield in unit area was positively correlated with the number of flowering plants and capitulum, but was weakly correlated with coverage.
85. Thus, Rabeprazole is efficiently converted into its active form in weakly acidic lumen. Why is this important for the unique inhibitory action of Rabeprazole?
86. Results: Fas antigen was weakly expressed on HL - 60 cells.
87. The tumor was immunoreactive for EMA, CK 7 , Vim, also weakly immunoreactive for CgA , but not for CK 34 ...
88. The prototype basin in Jurassic was a weakly extending depression; Begining Oligocene epoch, the basin was becoming intensively compressed and the structure distribution framework today was formed.
89. Pauli paramagnetism of an weakly interacting Fermi gas is studied. The expression of susceptibility is derived analytically .
90. The structure theorem of weakly left C-semigroups is also included as its special case.
More similar words: bleaklyweaklingweakweakenweaknessfrankly speakingweeklysicklymeeklypricklyquicklycrinklyfranklythicklybrisklybiweeklyprickly pearprickly heatwealweanwearweavesweatwearyswearweathersweatywealthwear offwear out
Total 142, 30 Per page  3/5  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words