Sentencedict.com
 Directly to word page Vague search(google)
Home > Tripper in a sentence

Tripper in a sentence

  up(0)  down(0)
Sentence count:17Posted:2017-08-12Updated:2020-07-24
Similar words: strippedstripped-downrippedgrippewhippersnapperrippledrippyrippingMeaning: ['trɪpə(r)]  n. 1. (slang) someone who has taken a psychedelic drug and is undergoing hallucinations 2. a walker or runner who trips and almost falls 3. a tourist who is visiting sights of interest 4. a catch mechanism that acts as a switch. 
Random good picture Not show
1. At weekends the beach is crowded with noisy trippers.
2. The beach was packed with day trippers.
3. Thousands of day trippers flock to resorts on the south coast.
4. We mention it particularly with Blackpool trippers in mind.
5. Six day trippers escaped unhurt when their hot air balloon hit power lines.
6. Opportunist photographers were now on hand for trippers who wanted their picture taken.
7. Not another ego tripper running for public office!
8. The pressure activates the tripper and releases the water.
9. A new - style audio remote tripper is presented, which adopts DTMF ( Dual Tone Multiple Frequency ) technology.
10. And the parameters of each component in tripper - circuit the experiment of 350 W xenon lamps.
11. Mantle slammed his third round - tripper of the day 21 st of the season.
12. From April to September the reserve is visited by day trippers six days a week.
13. From here, up in the windy pier gardens, you could look down and watch the trippers.
14. Blackpool now specialises in business conferences and both have many day trippers coming by car and coach.
14. Sentencedict.com is a online sentence dictionary, on which you can find nice sentences for a large number of words.
15. It was a strange feeling when four o'clock arrived and the day trippers departed.
16. A couple of hundred yards away pleasure boats, preparing for trippers, were berthed three abreast against the pier.
17. The properties and selection of the zero-phase sequence current transformer core and tripper for GFCI are in detail described.
More similar words: strippedstripped-downrippedgrippewhippersnapperrippledrippyrippingrippledcripplezippernipperdipperripplinggrippingcrippleddrippingdippedshipperskipperyippeetippetslippertippedflippercripplingslipperyclipperswhippetwhipped
Total 17, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words