Sentencedict.com
 Directly to word page Vague search(google)
Home > Shell in a sentence

Shell in a sentence

  up(19)  down(20)
Sentence count:205+6Posted:2016-07-16Updated:2020-07-24
Synonym: beatbeat outblastcarapacecasecasingcrushcuticleeggshellhuskplateracing shellscaleshieldtrouncevanquishSimilar words: helloshelfhelpwellbellyelltellcellMeaning: [ʃel]  n. 1. ammunition consisting of a cylindrical metal casing containing an explosive charge and a projectile; fired from a large gun 2. the material that forms the hard outer covering of many animals 3. hard outer covering or case of certain organisms such as arthropods and turtles 4. the hard usually fibrous outer layer of some fruits especially nuts 5. the exterior covering of a bird's egg 6. a rigid covering that envelops an object 7. a very light narrow racing boat 8. the housing or outer covering of something 9. a metal sheathing of uniform thickness (such as the shield attached to an artillery piece to protect the gunners) 10. the hard largely calcareous covering of a mollusc. v. 1. use explosives on 2. fall out of the pod or husk 3. hit the pitches of hard and regularly 4. look for and collect shells by the seashore 5. come out better in a competition, race, or conflict 6. remove from its shell or outer covering 7. remove the husks from. 
Random good picture Not show
61, The lack of a shell leaves the larvae unprotected against predators.
62, His spirit has left him and all that remains is the shell of his body.
63, Her normally shy son had come out of his shell.
64, After the fire the factory was completely burnt-out/just a burnt-out shell.
65, He's really come out of his shell since he met Marie.
66, The fire gutted the building, leaving just a charred shell.
67, I had hoped that university would bring him out of his shell .
68, The shell has to be slightly porous to enable oxygen to pass in.
69, The turtle's shell blended into the mud, making it almost invisible.
70, Making a shell is costly for a snail.
71, A twelve-pounder shell... burst right in front of me.
72, You can feel it bursting the shell.
73, The insect's shell gives it a tough protective covering.
74, Spread it into cooled baked pie shell.sentencedict.com/shell.html
75, He flew into an anti-aircraft shell with the precise catastrophe of a drunken driver speeding into a wall.
76, Unlike the solid cannon ball a mortar shell is hollow and filled with gunpowder.
77, Midge had lost an elder brother, killed by a shell on his nineteenth birthday in the Second World War.
78, Why not take an extra break at no extra cost - courtesy of Shell and air Miles?
79, Savoy Crunch peanuts are coated in a crispy shell in smoked bacon or sweet and sour flavours.
80, A great shell fell, buried itself in the ground, and exploded near where I stood.
81, He possibly held that the universe was slightly ovoid, with a crystalline outer shell to which the stars were attached.
82, In the center of this shell, above the burner, he placed a fire-clay crucible.
83, And if your car is fitted with a catalytic converter, Shell Advanced will help enhance the catalyst's performance.
84, Burying it all under a thick shell of bluster, bullying, slavish adherence to protocol and discipline.
85, Anyone who has tried to remove a hermit crab from its shell will know how tenacious these creatures can be.
86, It was even more volatile than a hang-fire on an artillery shell.
87, There was no evidence of more than 2 emission from the shell and no more than 1 from the central source.
88, The case was also, however, framed as a conspiracy between Shell and others to contravene the sanctions order.
89, Losing a leg to a shell, he quickly bled to death.
90, Brown calcareous soils contain carbonate materials in the form of rock or shell fragments.
More similar words: helloshelfhelpwellbellyelltellcellsellhelmetshelterswellspellhelpfulcannot helpselleras wellsell outyellowtell onsell offnonethelessto the lifeand the likesmell outwell knowndwell onsmell ofwell-knownin the least
Total 205, 30 Per page  3/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words