Sentencedict.com
 Directly to word page Vague search(google)
Home > Shell in a sentence

Shell in a sentence

  up(19)  down(21)
Sentence count:205+6Posted:2016-07-16Updated:2020-07-24
Synonym: beatbeat outblastcarapacecasecasingcrushcuticleeggshellhuskplateracing shellscaleshieldtrouncevanquishSimilar words: helloshelfhelpwellbellyelltellcellMeaning: [ʃel]  n. 1. ammunition consisting of a cylindrical metal casing containing an explosive charge and a projectile; fired from a large gun 2. the material that forms the hard outer covering of many animals 3. hard outer covering or case of certain organisms such as arthropods and turtles 4. the hard usually fibrous outer layer of some fruits especially nuts 5. the exterior covering of a bird's egg 6. a rigid covering that envelops an object 7. a very light narrow racing boat 8. the housing or outer covering of something 9. a metal sheathing of uniform thickness (such as the shield attached to an artillery piece to protect the gunners) 10. the hard largely calcareous covering of a mollusc. v. 1. use explosives on 2. fall out of the pod or husk 3. hit the pitches of hard and regularly 4. look for and collect shells by the seashore 5. come out better in a competition, race, or conflict 6. remove from its shell or outer covering 7. remove the husks from. 
Random good picture Not show
181, Prise open the shell to sea urchins , sea urchin eggs is delicious.
182, Semiconductor diode is a PN junction together with the corresponding client leads and package composition shell.
183, A reducer is an independent transmission device enclosed in a rigid shell.
184, Uage: It is used specially for the polishing glass shell of picture tube and semiconductor materials.
185, Oil Change Package include change of Shell Rimula - R 4 engine oiloil filter & oil plug gasket.
186, The ventral part of shell of a turtle or tortoise.
187, Leather and fabric stretched over the shell of a sea turtle form this unique looking pack.
188, Living near the seashore may lead to an interest in shells and shell collecting.
189, The brittle rachis may break when handled(sentencedict.com), and the berries may shell in storage.
190, Unnaturally warm in his hand, the shell rejuvenated Shemsen completely.
191, Perhaps the sea's definition of a shell is the peal.
192, Those Scorpion Shell obtained the lock A formula is a blast, or to buy the A?
193, A novel method for ear - orienting recognizing of the scallop shell is developed based on machine vision.
194, The hepatitis B virus cannot be caught by eating raw seafood like sashimi or shell fish.
195, The long whining whistle of a shell was followed by the dull boom of the explosion.
196, Objective : To identify the commercial Chinese medicines turtle shell and tortoise plastron.
197, If the outermost shell is incomplete, this element enters into chemical reaction.
198, The dynamic response at different positions flat end plat and cylindrical shell was comparatively analyzed.
199, I suspect that under that cynical shell you're at heart a sentimentalist.
200, Will of Necropolis no longer grants expertise and now lowers Anti - Magic Shell cooldown.
201, According to this story, God first created oyster shell,(http://sentencedict.com) then the eagle.
202, Core - shell structured noble metal nanocomposites processes high stability , excellently catalytic and optical properties.
203, A turtle has a hard, bony shell and a small, scaly head.
204, The noise level also depends on the angle and distance of the shell from the ear.
205, This should be the first in China to build oyster shell of the house written.
More similar words: helloshelfhelpwellbellyelltellcellsellhelmetshelterswellspellhelpfulcannot helpselleras wellsell outyellowtell onsell offnonethelessto the lifeand the likesmell outwell knowndwell onsmell ofwell-knownin the least
Total 205, 30 Per page  7/7  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words