Sentencedict.com
 Directly to word page Vague search(google)
Home > Penicillin in a sentence

Penicillin in a sentence

  up(2)  down(0)
Sentence count:217+7Posted:2017-03-19Updated:2020-07-24
Similar words: illicitfill inillicitlywillingmillingspillingwillinglythrillingMeaning: [‚penɪ'sɪlɪn]  n. any of various antibiotics obtained from Penicillium molds (or produced synthetically) and used in the treatment of various infections and diseases. 
Random good picture Not show
181. If there is an allergy to penicillin, physicians should consider azithromycin or a respiratory quinolone.
182. A typical drug aminopyrine, in addition to levamisole, semi-synthetic penicillin may also cause.
183. Mezlocillin sodium is a new kind of important semi-synthetic penicillin.
184. Results Dilution penicillin did not interfere with limulus agent in 120 diluted concentrations.
185. S-2-phenylpropionic acid was obtained by hydrolysis of 2-phenylpropionic ester catalyzed by penicillin G acylase (PGA) in the micro-aqueous phase.
186. Mary's Hospital Medical School in London, and went on to become known throughout the world as the noted Sir Alexander Fleming, the discoverer of Penicillin.
187. The active site of immobilized penicillin G acylase can be determined according to the precipitant produced in the reaction between phenylacetic acid and capture reagent.
188. OBJECTIVE To improve the HPLC method for identification and determination of Penicillin V potassium Tablets.
189. OBJECTIVE:The safety of oral penicillin V were test in Chinese without skin test.
190. The extraction of penicillin G with petroleum sulphoxide and di - isooctyl.
191. Intravenous antibiotics including Penicillin,(sentencedict.com/penicillin.html) Gentamicin and Metronidazole were urgently administered together with crystalloid rehydration.
192. The tests of bacterial inhibition in vitro showed that the efficacy of penicillin V.
193. Results:the es- say illustrates that it improves the quality of Penicillin and the rate of return on azeotropism crystallization.
194. Conclusion: Penicillin is a first selective drugs for lower respiratory tract infection.
195. The relationship between penicillin resistance and R plasmid was discussed.
196. Objectives:Make the protein flocculate sufficiency, reforming the effect of distilling. Method:Adjusting the quantity of adding PAMC in filtrate of penicillin.
197. When Sir Alexander Fleming discovered penicillin, he was not in a position to know the effect on society which his new medicine would produce.
198. You should be admitted to hospital and treated with penicillin and streptomycin.
199. It was found that penicillin acylase activity of the immobilized cells was more stable than that of the intact cells.
200. A basic application software system in VB6.0 is developed to realize on-line process monitoring towards the penicillin fermentation process.
201. Penicillin G sulfoxide diphenylcarbinol ester was synthesized by penicillin G potassium salt.
202. OBJECTIVE : To discuss the adverse drug reactions ( ADRs ) of penicillin in urinary system.
203. A booster does of tetanus toxoid and penicillin should be administered.
204. Identify the onset of disease in sucking pigs and inject 3 to 4 days prior to this to prevent disease, with long-acting penicillin.
205. Penicillin and magnamycin had continued antibacterial activity over a period of 7 days.
206. Conclusion: Cefradine aseptic screening and penicillin to eliminate enzyme inhibition, sterility test to ensure the accuracy of nature.
207. The cross reactivity of McAbs with ractopamine was 1.73%, and no cross reaction with adrenalin, nor adrenalin , isoprenaline, penicillin, enrofloxacin, BSA and OVA.
208. A coolie grabbed a handful of penicillin from a shelf.
209. We specialize in supply streptomycin, penicillin and other pharmacopoeia material below market price.
210. Forget about penicillin , digital computers and even the Big Bang, fads all of them.
More similar words: illicitfill inillicitlywillingmillingspillingwillinglythrillingfulfillingwillingnessunwillingnesspencildomicilepencil boxpencil casepenisvacillateoscillateeugeniceugenicsvacillationopeningpenitentphotogenichappeningpeninsulapenitencecynicismvilliimpenitent
Total 217, 30 Per page  7/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words