Sentencedict.com
 Directly to word page Vague search(google)
Home > Peccancy in a sentence

Peccancy in a sentence

  up(0)  down(0)
Sentence count:17Posted:2017-08-15Updated:2020-07-24
Similar words: peccantimpeccablepeccadilloimpeccablyimpeccabilityexpectancylife expectancymecca
Random good picture Not show
1. It deal with the peccancy information according to the picture from the Electronic Police Sysetem.
2. This paper introduces the algorithm of peccancy vehicle detection in the yellow grid region with practical application value, and it can be widely applied in the traffic management with low cost.
3. This system can note the cars' peccancy informatin, help police to manager the peccancy informatin and punish the drivers make the traffic become well.
4. It is applied in traffic peccancy visual monitoring system and makes the confirmation of peccant vehicle more automated and intelligent.
5. The method of vehicle peccancy surveillance is usually achieved through inductor buried in the ground or axle sensor.
6. In traffic peccancy detection and algorithm of background updating, we employ the vehicle detection technique based on morphological edge detection and background difference.
7. I believe the fact that enforcing the traffic control will, to a certain extent, cut down the traffic peccancy.
8. After discuss the process of the traffic checking and car's peccancy checking, the paper realize the counting arithmetic based on the background image's dynamic replacement and three times affirmed.
9. The designing way of the electron police system is introduced. The hardware structure and applying software are offered too. Function of managing towards peccancy vehicles is described.
10. The staff should propagandize actively the knowledge of using electricity safely to the users and restrict the action of peccancy in using electricity.
11. Non wearing helmet, improper wearing and taking helmet as seats are belong to the third species of peccancy.
12. The pretreatments was imposed on the sampled real-time image sequence. The colorized virtual loops blocking algorithm is used to detect red lights runners and catch process of peccancy.
13. Big risks may be triggered by tiny loophole. Habitual peccancy is a detailed problem which results in the accidents.
13. Wish you can benefit from our online sentence dictionary and make progress day by day!
14. The monitoring system uses three cameras to obtain the far and near scenes at the same time to record the video and license plate of the vehicle of peccancy for future punishment.
15. Finally, it combines the result of VLD with the result of moving detection to estimate vehicles peccancy.
16. For the wide application and demand of intelligent traffic monitoring, this paper puts forward an algorithm to detect the peccancy vehicle in the yellow grid region.
17. This study uncovers five kinds of political risk faced by Chinese enterprises and citizen, that is, violent event, policeman peccancy, racialism , human rights, and personal reasons.
More similar words: peccantimpeccablepeccadilloimpeccablyimpeccabilityexpectancylife expectancymeccafancychancyvacancytruancyinfancytenancypliancyvagrancyvibrancypiquancydormancybuoyancyoccupancystagnancyconstancypregnancyredundancymilitancyhesitancypoignancytrenchancybrilliancy
Total 17, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words