Sentencedict.com
 Directly to word page Vague search(google)
Home > Malathion in a sentence

Malathion in a sentence

  up(0)  down(0)
Sentence count:25Posted:2017-12-11Updated:2020-07-24
Similar words: glutathionekemal ataturkinhalationescalationexhalationgravitational attractionde-escalationmaladministrationMeaning: n. a yellow insecticide used as a dust or spray to control garden pests and house flies and mites. 
Random good picture Not show
(1) The determination of malathion residues in grain by gas chromatography is introduced.
(2) Including, thiabendazole, or mycophenolate triazole, Prochloraz amines, malathion, and so IPRODIONE.
(3) The presence of Permethrin or Fenthion, Malathion, Trichlorfon and Omethoate increased the fluorescence intensity of DPH in the mitochondrial membrane.
(4) Malathion is a type of insecticide that works well against head lice.
(5) The method for using Malathion is to apply the Malathion to dry hair and leave for eight hours, after the eight hours you can wash the Malathion out.
(6) Its main effective components are permethrin, Bassa and malathion, and it is compounded with synergistic and emulsion and is built by making up the surplus with fluid wax.
(7) The measuring process of malathion content in corn with gas chromatography is analyzed.
(8) Determination of methamidophos, malathion, fenthion residues in beestings by gas chromatography.
(9) The determination of malathion residue in rice by capillary column gas chromatography was studied.
(10) Malathion is an organophosphorus insecticide with high selective toxicity and widely used. But it is highly toxic for aquatic organism. Sentencedict.com
(11) Prioderm lotion contains the active ingredient malathion , which is an organophosphorous insecticide that kills parasites such as head lice, pubic lice and scabies mites.
(12) Used for dispensing perchloride cream and fenvalerate malathion cream, lower use level and good effects.
(13) It was found that Malathion degrades faster in water samples than in rice plant and soil.
(14) The residual dynamics of Malathion in rice plant, soil, water samples were determined by NP Gas Chromatography.
(15) Imagine dusting each bud with a soft brush and malathion dust!
(16) The changes of susceptibility of cotton bollworm larvae to phoxim, malathion, methomyl, deltamethrin and p-cypermethrin was significantly difference with treatments of three anticholinesterase agents.
(17) Gas chromatography equipped with a nitrogen-phosphorus detector was used in the field residue decline study and final residues of malathion in citrus and soil.
(18) Based on the esterase inhibition actions of pesticides, different concentrations of dichlorvos, trichlorfon , malathion and carbaryl were determined by free and immobilized chicken liver esterase.
(19) Seven kinds of clay powder: attapulgite, halloysite, bentonite, diatomite, kaolin, talc and rice-hull ash were soaked in the protectant Solutions: malathion, fenitrothion and pirimiphos methyl.
(20) Plants have to literally be drenched (particularly if harboring hard-shelled beetles) daily in rotenone, while malathion can be used sparingly,[sentencedict.com] and needs to be applied only occasionally.
(21) A high performance GC method was established for determination of determination, parathion-methyl and malathion residues in marine organisim.
(22) A field experiment was conducted to reveal residual dynamics and the final residues of phorate and malathion in peanut and soil, and application safety was assessed.
(23) It is good practice to buy ready made treatments of Malathion because in large doses it can affect the human nervous system.
(24) There were not significant changes in the specific activity and Km value of AChE after induction by LD10 of malathion and methomyl over two generational.
(25) Experiments reveal that the grain and flour mixed with malathion powder is a good method in controlling angoumois grain moth.
More similar words: glutathionekemal ataturkinhalationescalationexhalationgravitational attractionde-escalationmaladministrationintercalationethiopiamalamalarmalayamaladymalawihimalayamalapertmalaccamalaisemalariamalaciaathermalhimalayanmalarkeymalamutehimalayasmala fidemalaysiamalachitemaladroit
Total 25, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words