Sentencedict.com
 Directly to word page Vague search(google)
Home > Expensively in a sentence

Expensively in a sentence

  up(0)  down(0)
Sentence count:43Posted:2017-09-01Updated:2020-07-24
Similar words: expensiveinexpensivepensivelyexpansivelyoffensivelyintensivelyextensivelydefensivelyMeaning: adv. in an expensive manner. 
Random good picture Not show
1. The villa was expensively furnished throughout.
2. She was expensively dressed, with fine furs and jewels.
3. She's always expensively dressed.
4. The back had its share of expensively educated people.
5. He dressed expensively, wore hand-made shoes and pure silk shirts.
6. The extraction of expensively heated warm air from the laboratory through fume cupboards is another area of concern.
7. But be prepared to entertain yourself: The expensively appointed restaurant usually is subdued and was deathly quiet on a recent visit.
8. Unsliced wholemeal bread which has not been expensively purified exchanges for more than its sliced white imitation.
9. When selling expensively, we return earn much ah!
10. They do a third-rate job very expensively.
11. A seller wants to sell as expensively as possible.
12. Sellers want to sell expensively as possible.
13. Handsome and faultlessly groomed, he wore expensively tailored suits, fine silk shirts and ties.
14. Her gaze scanned the expensively tailored cut of his dark suit.
15. Exognosis is a diagnostic method that is expensively applied in Shanghanlun.
16. At a debutante ball, the expensively - gowned girls stand in a line to be introduced individually.
17. And we think we can do it less expensively and with greater effectiveness.
18. An expensively dressed little man turned a corner and approached her.
19. There are other restaurants where you can eat less expensively.
20. Housing benefit is over budget, partly because of the rise in the number of homeless families having to be expensively bed-and-breakfasted.
21. How will other members of society benefit from having expensively financed their being there?
22. The air is cleaned and then recirculated without the loss of expensively generated heat that occurs with extractor fans.
23. Determined to make the house a Mecca for the rich and famous, he decorated it elaborately and expensively.
24. The Royal children might even pass a few exams which is more than their expensively educated Mummies and Daddies managed.
24. Sentencedict.com is a online sentence dictionary, on which you can find nice sentences for a large number of words.
25. The company said a small herd of goats can produce protein-based medicines less expensively than a giant manufacturing plant.
26. Analysts are divided over whether Fore and the other expensively acquired businesses will ever make a decent return for shareholders.
27. And let me explain what I meant by that silly passage in my last letter, about expensively dressed girls.
28. Meredith had only time to see that she was expensively dressed, sharp-featured and bad-tempered in looks.
29. The MF voice coil is of copper-coated aluminium ribbon, expensively edge-wound over a polyimide former to increase sensitivity by maximising the amount of copper in the magnet gap.
30. No evil could come out of the contemplation of an expensively decorated chamber.
More similar words: expensiveinexpensivepensivelyexpansivelyoffensivelyintensivelyextensivelydefensivelycomprehensivelyapprehensivelypensiveexpressivelysensitivelyinsensitivelyexpenseexpensesspare no expenseat the expense ofexpense accountexpansiveoffensivevariable expensespassivelymassivelyevasivelyintensivedefensiveextensivederisivelyabrasively
Total 43, 30 Per page  1/2  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words